PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02051
Common NameKK1_002102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 207aa    MW: 23981.9 Da    PI: 5.1527
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02051genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM80.14.9e-25141391128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekew..yfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    lp Gf F+P+de l  +yL+kk+ +++l+  ++i+e+d++++ePw+L+    +++ +w  yfF   + +  ++   +  + +g W+a  + +++  
  C.cajan_02051  14 LPIGFCFDPSDEVLTGYYLRKKILSQPLPH-NFIPECDVFQTEPWRLQGG--GRHLNWqkYFFYDPKDRVFEN-TVKIGAGNGEWRAVERGEQIEL 105
                    699************************999.89**************943..223344446666555555443.34445689************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++ + +  ++t vf++ ++++  +++Wvm+e++l
  C.cajan_02051 106 SSIQMIAQRNTYVFWERNDNNFIRSNWVMKEFHL 139
                    99999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-3111154IPR003441NAC domain
PROSITE profilePS5100530.12914155IPR003441NAC domain
PfamPF023652.1E-1315139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MELPNESEAR TYRLPIGFCF DPSDEVLTGY YLRKKILSQP LPHNFIPECD VFQTEPWRLQ  60
GGGRHLNWQK YFFYDPKDRV FENTVKIGAG NGEWRAVERG EQIELSSIQM IAQRNTYVFW  120
ERNDNNFIRS NWVMKEFHLA LNSNPSLRFC MGVYRIFEME GRRAKKLRMS GEEASTSGND  180
GEANDVTPTI GDLTQEYGSV ASTSQVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-131413915140Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_02051
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020224897.11e-156NAC domain-containing protein 41
TrEMBLA0A151SM051e-154A0A151SM05_CAJCA; NAC domain-containing protein 7
STRINGGLYMA16G05620.15e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF134131127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33480.19e-20NAC domain containing protein 41