PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02050
Common NameKK1_002101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 163aa    MW: 19138.9 Da    PI: 6.9731
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02050genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM791.1e-24101333128
            NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekew..yfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                     GfrF+Ptd+ l  +yL++ ++++  +  +vi+e d+++++Pw Lp    +++ +w  +fF +   +   ++  +r++ +g W+   kd++     
  C.cajan_02050  10 IGFRFDPTDDILAGYYLRRILAQSL-PN-DVIQEYDVFQTQPWGLPG--GEKHLNWlkFFFYNIGARV-FENPDKRVAGNGQWRIMEKDEDFQLPt 100
                    6****************98777665.55.69***************3..2344577755665555544.567899999**************9984 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    k + +  +++Lvf++++ ++ ++t+W+mhe++l
  C.cajan_02050 101 KLQWIAKRNILVFWEAKGNRFTETNWMMHEFHL 133
                    555699999**********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-256140IPR003441NAC domain
PROSITE profilePS5100528.2938152IPR003441NAC domain
PfamPF023652.6E-1410133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MELQNHSESI GFRFDPTDDI LAGYYLRRIL AQSLPNDVIQ EYDVFQTQPW GLPGGEKHLN  60
WLKFFFYNIG ARVFENPDKR VAGNGQWRIM EKDEDFQLPT KLQWIAKRNI LVFWEAKGNR  120
FTETNWMMHE FHLAPKSNPS QVNIIINTIV STIITIKIVQ QLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-161113318140Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_02050
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020225203.14e-98NAC domain-containing protein 2
TrEMBLA0A151SM711e-118A0A151SM71_CAJCA; Putative NAC domain-containing protein 94
STRINGXP_007161703.18e-58(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF134131127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.19e-21NAC domain containing protein 94