PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g050650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MIKC_MADS
Protein Properties Length: 352aa    MW: 40286.6 Da    PI: 4.6708
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g050650.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.33.1e-26958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtfskRrng++KKA+ELS+LCd+++a+++fs++++l  +s
  Csa07g050650.1  9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALLMFSPSDRLSLFS 58
                    79******************************************998776 PP

2K-box13.72.7e-06121191979
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqiee 79 
                     + +++ e+l++e+ kL+++++  ++e+R++  +     +++e +  e+qL + l++i ++++++l +  ++
  Csa07g050650.1 121 AINSDVEELEHEVYKLQQQLHIAEEELRKYEPDPNRFTTIEEYETCEKQLTDTLTRIGQRREHILNDLSSY 191
                     55678999******************************************************999876555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.9E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.805161IPR002100Transcription factor, MADS-box
CDDcd002653.84E-34275No hitNo description
SuperFamilySSF554559.29E-29281IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-24323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.4E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-243859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRVKLEIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALLMFSP SDRLSLFSGK  60
TRIEDVFSRY INLSDQEREN ALVFPDQSRR PDFQSKEYLL RTLQQLKTEN DIALQLTNPA  120
AINSDVEELE HEVYKLQQQL HIAEEELRKY EPDPNRFTTI EEYETCEKQL TDTLTRIGQR  180
REHILNDLSS YEASAIQQQQ NMGGPFVTDV VGGWLSENGP NQAHLFDASA HSAMYETLLQ  240
GSSSSSNQNN IMGESNVSNH NGDMFQEWAQ TYNSTTGHNP SALFPPMQQQ QHQYQHGLVG  300
SSNVEEIEIP IMKEEAQADH EVSDYHIMKR EAQADHEVSD YDIRMPQLSS Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A9e-18190191MEF2 CHIMERA
6bz1_B9e-18190191MEF2 CHIMERA
6bz1_C9e-18190191MEF2 CHIMERA
6bz1_D9e-18190191MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa07g050650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464410.0DQ446441.1 Arabidopsis thaliana clone pENTR221-At1g77980 MADS-box family protein (At1g77980) mRNA, complete cds.
GenBankDQ6529400.0DQ652940.1 Arabidopsis thaliana clone 0000013056_0000009401 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019082857.10.0PREDICTED: agamous-like MADS-box protein AGL66
SwissprotQ1PFC20.0AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLR0HW850.0R0HW85_9BRAS; Uncharacterized protein
STRINGXP_010416762.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.10.0AGAMOUS-like 66
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]