PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa02g071150.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

Dof

Protein Properties

Length: 119aa MW: 12994.7 Da PI: 8.4887

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa02g071150.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	110.6	7.4e-35	70	119	3	52
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvG 52 ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvG Csa02g071150.1 70 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVG 119 6789*********************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-32	58	119	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	8.3E-30	71	119	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	26.496	73	119	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	75	111	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 119 aa Download sequence Send to blast
MGLTSLQVCM DSDWLQEAES SGGSMLDSST TSPSAADILA ACSTRPQASA VAVAAAALMD 60 GGRRLRPPHD HPQKCPRCES THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GTLRNIPVG

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250\|UniProtKB:Q9M2U1, ECO:0000269\|PubMed:19915089, ECO:0000269\|PubMed:30626969}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa02g071150.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK228992	1e-156	AK228992.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL16-29-O12.
GenBank	BT020467	1e-156	BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBank	BT020576	1e-156	BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006394333.2	3e-84	dof zinc finger protein DOF5.6
Swissprot	Q9FM03	2e-84	DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBL	R0EWI4	5e-83	R0EWI4_9BRAS; Uncharacterized protein
TrEMBL	R0GQW6	7e-83	R0GQW6_9BRAS; Uncharacterized protein
STRING	XP_006280650.1	1e-83	(Capsella rubella)
STRING	XP_010444159.1	1e-83	(Camelina sativa)
STRING	XP_010459469.1	1e-83	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6374	27	46

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62940.1	4e-76	Dof family protein

Publications ? help Back to Top
Miyashima S, et al. Mobile PEAR transcription factors integrate positional cues to prime cambial growth. Nature, 2019. 565(7740): p. 490-494 [PMID:30626969]