PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590887.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MIKC_MADS
Protein Properties Length: 329aa    MW: 37651.9 Da    PI: 4.7813
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590887.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.33.1e-26958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtfskRrng++KKA+ELS+LCd+++a+++fs++++l  +s
  XP_013590887.1  9 KRIENNTNRQVTFSKRRNGLIKKAYELSILCDIDIALLMFSPSDRLSLFS 58
                    79******************************************998776 PP

2K-box18.96.5e-08120200888
           K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                     s+ +++ ++l+qe+ +L++++++ ++e+R++  +     +++e +  e++L + l+++ ++++++l +q++       ++q
  XP_013590887.1 120 SAINSDVQELEQEVYRLQQQLHMAEKELRKYEPDPSRFTTMEEYEACEKKLIETLTHVTQRREHILSDQLSSYETSAMQHQ 200
                     4667889**************************************************************998877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.819161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-28281IPR002100Transcription factor, MADS-box
CDDcd002655.63E-33275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-24323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-243859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-5125200IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRVKLEIKR IENNTNRQVT FSKRRNGLIK KAYELSILCD IDIALLMFSP SDRLSLFSGK  60
TRVEDVFTRF INLPDQEREN ALTFTDQSRR PDFQSKEYLL RTLQQLKTEN DIALQLTNPS  120
AINSDVQELE QEVYRLQQQL HMAEKELRKY EPDPSRFTTM EEYEACEKKL IETLTHVTQR  180
REHILSDQLS SYETSAMQHQ NMGGPFVNDV AGGWLAENGP IQTQLFDASA NSAIYETLLQ  240
GSSSSSNQNN NMSECNVTNH NGDMFQEWAQ AYTSTTGLNP SALFPPIQHQ HGLVDPNIKE  300
SEIPVITREA QADHEVSDYD IRMPQLSSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A5e-17190191MEF2 CHIMERA
6bz1_B5e-17190191MEF2 CHIMERA
6bz1_C5e-17190191MEF2 CHIMERA
6bz1_D5e-17190191MEF2 CHIMERA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013590887.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590887.10.0PREDICTED: MADS-box protein SOC1 isoform X1
SwissprotQ1PFC20.0AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLA0A0D3D1G90.0A0A0D3D1G9_BRAOL; Uncharacterized protein
TrEMBLA0A3P6HFH20.0A0A3P6HFH2_BRAOL; Uncharacterized protein
STRINGBo6g121640.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.10.0AGAMOUS-like 66
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]