PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00057317001 | ||||||||
Common Name | GSBRNA2T00057317001, LOC106365148 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 318aa MW: 35748.1 Da PI: 8.9322 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 177.7 | 3.1e-55 | 16 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeel+++yL +k+++++++ ++i++vd++k+ePw+Lp+k+k + kewyfFs rd+ky+tg r+nrat++gyWk+tgkdk GSBRNA2T00057317001 16 LPPGFRFHPTDEELISYYLVNKIADQNFTG-KAIADVDLNKSEPWELPEKAKMGGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDK 104 79*************************999.88***************99999************************************* PP NAM 91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 e+l++ ++elvg+kktLvfy+grap+gekt+Wvmheyrl GSBRNA2T00057317001 105 EILNStTSELVGMKKTLVFYRGRAPRGEKTSWVMHEYRL 143 ***9878889***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.84E-63 | 13 | 165 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.899 | 16 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.8E-29 | 17 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 318 aa Download sequence Send to blast |
MEQGDHQQQK KEEEALPPGF RFHPTDEELI SYYLVNKIAD QNFTGKAIAD VDLNKSEPWE 60 LPEKAKMGGK EWYFFSLRDR KYPTGVRTNR ATNTGYWKTT GKDKEILNST TSELVGMKKT 120 LVFYRGRAPR GEKTSWVMHE YRLHSKSSYR TSKQDEWVVC RVLKKTEATK KYTSNCSSST 180 SHHHQSHTRA SILSTNNNNP NYSSDLLQLP AHLQPHTSLN INQTIMANAV HLAELSRVFR 240 ASTSSTMDSA HQQLMSYSHM PVSGLNLNLG GGLVQPAPPA VSLEDVVAVS ASFTGQNGFG 300 NVEMSQCMDL YGYWPSY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 9e-58 | 15 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 9e-58 | 15 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 9e-58 | 15 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 9e-58 | 15 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swm_B | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swm_C | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swm_D | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_A | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_B | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_C | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_D | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
4dul_A | 9e-58 | 15 | 171 | 16 | 171 | NAC domain-containing protein 19 |
4dul_B | 9e-58 | 15 | 171 | 16 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First observed in young embryonic SAM. Later confined to the boundaries between cotyledon primordia and the SAM. In mature embryos, localized around first leaves primordia. Only weakly present in vegetative SAM. In inflorescence, observed at the boundaries between floral organ primordia. In callus, expressed during transition to shoot development, with a progressive restriction to specific areas corresponding to future shoot apex. {ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12492830}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in inflorescence stems, rosette leaves, aerial parts of seedlings, flowers, floral buds and roots. {ECO:0000269|PubMed:11245578}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00057317001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC006403 | 1e-160 | AC006403.4 Arabidopsis thaliana chromosome 2 clone T28I24 map mi238, complete sequence. | |||
GenBank | CP002685 | 1e-160 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022547573.1 | 0.0 | protein CUP-SHAPED COTYLEDON 1 | ||||
Swissprot | Q9FRV4 | 6e-80 | NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1 | ||||
TrEMBL | A0A078HD82 | 0.0 | A0A078HD82_BRANA; BnaA09g41400D protein | ||||
TrEMBL | A0A397Y2R9 | 0.0 | A0A397Y2R9_BRACM; Uncharacterized protein | ||||
STRING | Bra007855.1-P | 0.0 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6851 | 28 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24430.2 | 0.0 | NAC domain containing protein 38 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106365148 |