![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00021575001 | ||||||||
Common Name | GSBRNA2T00021575001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 133aa MW: 15989.9 Da PI: 6.8798 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 65.4 | 7.6e-21 | 63 | 118 | 1 | 56 |
TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +++ +++t+ q++eLe++F+++++p+ ++r+eL+++l+L+ qVk+WFqN+R+++k GSBRNA2T00021575001 63 KKRYHRHTQRQIQELESFFKECPHPDDKQRKELSRELNLEPLQVKFWFQNKRTQMK 118 678899***********************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.2E-24 | 44 | 118 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.56E-20 | 51 | 118 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.876 | 60 | 120 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.2E-17 | 61 | 124 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.35E-16 | 63 | 118 | No hit | No description |
Pfam | PF00046 | 1.6E-18 | 63 | 118 | IPR001356 | Homeobox domain |
PROSITE pattern | PS00027 | 0 | 95 | 118 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MYQPNMFESH HHMFDMTPKN SDNDLGLTGS REDDFETKSG AEVTMENPLE EELQDPNQRP 60 NKKKRYHRHT QRQIQELESF FKECPHPDDK QRKELSRELN LEPLQVKFWF QNKRTQMKVH 120 TRANCYSFCI FI* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First expressed in the apical cell after the first asymmetric division of the zygote. Expressed in all proembryo cells until the eight-cell stage, and then restricted to the protoderm in the 16-cell proembryo. Not detected in the torpedo stage, but reappeared later in the L1 layer of the shoot apical meristem in the mature embryo. After germination, the L1 layer-specific expression pattern is maintained in the vegetative shoot apical meristem, inflorescence, floral meristems, and the young floral organ primordia. Finally, expressed in the protoderm of the ovule primordia and integuments and gradually restricted to the endothelium surrounding the embryo sac. {ECO:0000269|PubMed:10571886, ECO:0000269|PubMed:8989876}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in cell specification and pattern formation during embryogenesis. Binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to PDF2. {ECO:0000269|PubMed:11439135, ECO:0000269|PubMed:12505995}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00021575001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK229970 | 1e-128 | AK229970.1 Arabidopsis thaliana mRNA for L1 specific homeobox gene ATML1/ovule-specific homeobox protein A20, complete cds, clone: RAFL22-43-B20. | |||
GenBank | AY091104 | 1e-128 | AY091104.1 Arabidopsis thaliana putative L1-specific homeobox gene ATML1/ovule-specific homeobox protein A20 (At4g21750) mRNA, complete cds. | |||
GenBank | AY150491 | 1e-128 | AY150491.1 Arabidopsis thaliana putative L1-specific homeobox gene ATML1/ovule-specific homeobox protein A20 (At4g21750) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013598423.1 | 3e-81 | PREDICTED: homeobox-leucine zipper protein MERISTEM L1 | ||||
Refseq | XP_013598424.1 | 3e-81 | PREDICTED: homeobox-leucine zipper protein MERISTEM L1 | ||||
Refseq | XP_013598425.1 | 3e-81 | PREDICTED: homeobox-leucine zipper protein MERISTEM L1 | ||||
Refseq | XP_013696499.1 | 4e-81 | homeobox-leucine zipper protein MERISTEM L1 | ||||
Refseq | XP_013696501.1 | 4e-81 | homeobox-leucine zipper protein MERISTEM L1 | ||||
Refseq | XP_013696503.1 | 4e-81 | homeobox-leucine zipper protein MERISTEM L1 isoform X2 | ||||
Refseq | XP_018477464.1 | 4e-81 | PREDICTED: homeobox-leucine zipper protein MERISTEM L1 | ||||
Refseq | XP_022546647.1 | 4e-81 | homeobox-leucine zipper protein MERISTEM L1 isoform X1 | ||||
Refseq | XP_022546648.1 | 4e-81 | homeobox-leucine zipper protein MERISTEM L1 | ||||
Swissprot | Q8RWU4 | 4e-78 | ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1 | ||||
TrEMBL | A0A078GCK0 | 8e-95 | A0A078GCK0_BRANA; BnaC07g30910D protein | ||||
STRING | Bo7g107550.1 | 1e-80 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM491 | 28 | 149 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21750.2 | 2e-80 | HD-ZIP family protein |