![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00033.166 | ||||||||
Common Name | AMTR_s00033p00200970 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 63aa MW: 7238.4 Da PI: 10.3611 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.8 | 3.9e-16 | 9 | 54 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+W +eEde+l+++v+q+G+++W++I ++ + Rt+k+c++rw + evm_27.model.AmTr_v1.0_scaffold00033.166 9 KGPWMPEEDEILLEYVRQHGPRDWSAIRSKGLLPRTGKSCRLRWVN 54 79*************************8876677**********87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.014 | 1 | 60 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-21 | 7 | 61 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.45E-16 | 7 | 61 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.7E-12 | 8 | 58 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-14 | 9 | 54 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.54E-12 | 11 | 56 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 63 aa Download sequence Send to blast |
MFDAGAMRKG PWMPEEDEIL LEYVRQHGPR DWSAIRSKGL LPRTGKSCRL RWVNKLNPDV 60 KT* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006852860.3 | 2e-38 | transcription factor MYB97 | ||||
Swissprot | Q0JB89 | 2e-27 | MYB58_ORYSJ; Probable transcription factor MYB58 | ||||
TrEMBL | U5CYV5 | 1e-38 | U5CYV5_AMBTC; Uncharacterized protein | ||||
STRING | ERN14327 | 2e-39 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60460.1 | 2e-25 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00033.166 |
Publications ? help Back to Top | |||
---|---|---|---|
|