PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G65070.1

Common Name

AGL69, FCL4, MAF4

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 200aa MW: 22853.5 Da PI: 8.904

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G65070.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	74.5	8.3e-24	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienks rqvtf+kRrng++ KA LS+LC+ va+ii+s tg+ly +ss AT5G65070.1 9 KRIENKSSRQVTFCKRRNGLMEKARQLSILCESSVALIIISATGRLYSFSS 59 79***********************************************96 PP
2	K-box	35.4	4.5e-13	112	164	46	98
K-box 46 LslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 s+ L++Le+qL+++l+ R++K+el++e +++ q+kek l+een++L+++l AT5G65070.1 112 VSIDCLKSLEEQLKTALSVTRARKTELMMELVKTHQEKEKLLREENQSLTNQL 164 56777********************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.1E-32	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.254	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.57E-26	2	72	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.18E-33	2	78	No hit	No description
PRINTS	PR00404	7.6E-25	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.4E-22	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.6E-25	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.6E-25	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	10.265	80	173	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.3E-8	108	164	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009910	Biological Process	negative regulation of flower development
GO:0005634	Cellular Component	nucleus
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl

Sequence ? help Back to Top
Protein Sequence Length: 200 aa Download sequence Send to blast
MGRRKVEIKR IENKSSRQVT FCKRRNGLME KARQLSILCE SSVALIIISA TGRLYSFSSG 60 DSMAKILSRY ELEQADDLKT LDLEEKTLNY LSHKELLETI QCKIEEAKSD NVSIDCLKSL 120 EEQLKTALSV TRARKTELMM ELVKTHQEKE KLLREENQSL TNQLIKMGKM KKSVEAEDAR 180 AMSPESSSDN KPPETLLLLK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-18	1	70	1	69	MEF2C
5f28_B	6e-18	1	70	1	69	MEF2C
5f28_C	6e-18	1	70	1	69	MEF2C
5f28_D	6e-18	1	70	1	69	MEF2C
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	247223_at	0.0
Expression Atlas	AT5G65070	-
AtGenExpress	AT5G65070	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes MADS-box containing FLC paralog. Five splice variants have been identified but not characterized with respect to expression patterns and/or differing function. Overexpression of the gene in the Landsberg ecotype leads to a delay in flowering, transcript levels of MAF4 are reduced after a 6 week vernalization.
UniProt	Transcription factor involved in the negative regulation of flowering time in short days, probably through the photoperiodic and vernalization pathways. Prevents premature flowering, particularly in the cv. Landsberg erecta background. In non-inductive photoperiods (e.g. short days), required for flowering through VIL2-mediated maintenance of the epigenetically repressed state of MAF5 via H3K9me2 and plant homeodomain / polycomb repressive complex 2 (PHD-PRC2)-dependent H3K27me3. {ECO:0000269\|PubMed:12724541, ECO:0000269\|PubMed:18798874, ECO:0000269\|PubMed:18852898, ECO:0000269\|PubMed:20837520, ECO:0000269\|PubMed:21150261, ECO:0000269\|PubMed:21175890, ECO:0000269\|PubMed:21398257, ECO:0000269\|PubMed:22378382}.

Function -- GeneRIF ? help Back to Top
MADS AFFECTING FLOWERING 4 (MAF4) and MAF5 are also upregulated in TEK knockdown plants. [PMID: 23733063] RING1A suppresses the expression of MAF4 and MAF5 through affecting H3K27me3 levels at these loci to regulate the floral transition [PMID: 24553292] MAS activates MAF4 by interacting with WDR5a, one core component of the COMPASS-like complexes, and recruiting WDR5a to MAF4 to enhance histone 3 lysine 4 trimethylation (H3K4me3 [PMID: 30498193]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G65070.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by vernalization. Repressed by VIL2, AGL6, CLF, EMF2 and FIE via epigenetic chromatin H3K27me3 and H3K9me2 regulation during the vegetative development. {ECO:0000269\|PubMed:12724541}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G65070

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY231450	0.0	AY231450.1 Arabidopsis thaliana MADS affecting flowering 4 variant I (MAF4) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_201312.2	1e-141	K-box region and MADS-box transcription factor family protein
Swissprot	Q683D7	5e-90	MAF5_ARATH; Protein MADS AFFECTING FLOWERING 5
TrEMBL	Q84NB2	1e-140	Q84NB2_ARATH; K-box region and MADS-box transcription factor family protein
STRING	AT5G65070.3	1e-132	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT5G65070.1
Entrez Gene	836631
iHOP	AT5G65070
wikigenes	AT5G65070

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Rossel JB,Wilson IW,Pogson BJ Global changes in gene expression in response to high light in Arabidopsis. Plant Physiol., 2002. 130(3): p. 1109-20 [PMID:12427978] Ratcliffe OJ,Kumimoto RW,Wong BJ,Riechmann JL Analysis of the Arabidopsis MADS AFFECTING FLOWERING gene family: MAF2 prevents vernalization by short periods of cold. Plant Cell, 2003. 15(5): p. 1159-69 [PMID:12724541] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] N Large-scale analysis of in vivo phosphorylated membrane proteins by immobilized metal ion affinity chromatography and mass spectrometry. Mol. Cell Proteomics, 2003. 2(11): p. 1234-43 [PMID:14506206] Albert VA, et al. Floral gene resources from basal angiosperms for comparative genomics research. BMC Plant Biol., 2005. 5: p. 5 [PMID:15799777] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Deal RB,Kandasamy MK,McKinney EC,Meagher RB The nuclear actin-related protein ARP6 is a pleiotropic developmental regulator required for the maintenance of FLOWERING LOCUS C expression and repression of flowering in Arabidopsis. Plant Cell, 2005. 17(10): p. 2633-46 [PMID:16141450] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Wang J,Tian L,Lee HS,Chen ZJ Nonadditive regulation of FRI and FLC loci mediates flowering-time variation in Arabidopsis allopolyploids. Genetics, 2006. 173(2): p. 965-74 [PMID:16547097] Deal RB,Topp CN,McKinney EC,Meagher RB Repression of flowering in Arabidopsis requires activation of FLOWERING LOCUS C expression by the histone variant H2A.Z. Plant Cell, 2007. 19(1): p. 74-83 [PMID:17220196] Conte MG,Gaillard S,Droc G,Perin C Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants. BMC Genomics, 2008. 9: p. 183 [PMID:18426584] Xu L, et al. The E2 ubiquitin-conjugating enzymes, AtUBC1 and AtUBC2, play redundant roles and are involved in activation of FLC expression and repression of flowering in Arabidopsis thaliana. Plant J., 2009. 57(2): p. 279-88 [PMID:18798874] Cao Y,Dai Y,Cui S,Ma L Histone H2B monoubiquitination in the chromatin of FLOWERING LOCUS C regulates flowering time in Arabidopsis. Plant Cell, 2008. 20(10): p. 2586-602 [PMID:18849490] Day RC,Herridge RP,Ambrose BA,Macknight RC Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation. Plant Physiol., 2008. 148(4): p. 1964-84 [PMID:18923020] Caicedo AL,Richards C,Ehrenreich IM,Purugganan MD Complex rearrangements lead to novel chimeric gene fusion polymorphisms at the Arabidopsis thaliana MAF2-5 flowering time gene cluster. Mol. Biol. Evol., 2009. 26(3): p. 699-711 [PMID:19139056] Yu CW, et al. HISTONE DEACETYLASE6 interacts with FLOWERING LOCUS D and regulates flowering in Arabidopsis. Plant Physiol., 2011. 156(1): p. 173-84 [PMID:21398257] Rosloski SM, et al. Functional analysis of splice variant expression of MADS AFFECTING FLOWERING 2 of Arabidopsis thaliana. Plant Mol. Biol., 2013. 81(1-2): p. 57-69 [PMID:23111501] Xu Y,Gan ES,Ito T The AT-hook/PPC domain protein TEK negatively regulates floral repressors including MAF4 and MAF5. Plant Signal Behav, 2014. [PMID:23733063] Shen L, et al. The putative PRC1 RING-finger protein AtRING1A regulates flowering through repressing MADS AFFECTING FLOWERING genes in Arabidopsis. Development, 2014. 141(6): p. 1303-12 [PMID:24553292] Liu B, et al. Interplay of the histone methyltransferases SDG8 and SDG26 in the regulation of transcription and plant flowering and development. Biochim. Biophys. Acta, 2016. 1859(4): p. 581-90 [PMID:26854085] Gong X,Shen L,Peng YZ,Gan Y,Yu H DNA Topoisomerase Iα Affects the Floral Transition. Plant Physiol., 2017. 173(1): p. 642-654 [PMID:27837087] Cui Z, et al. SKIP controls flowering time via the alternative splicing of SEF pre-mRNA in Arabidopsis. BMC Biol., 2017. 15(1): p. 80 [PMID:28893254] Zhao X, et al. Global identification of Arabidopsis lncRNAs reveals the regulation of MAF4 by a natural antisense RNA. Nat Commun, 2018. 9(1): p. 5056 [PMID:30498193]