Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 63.2 | 3.9e-20 | 13 | 72 | 3 | 57 |
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
+R+++tk+q++ Le+l+++ r+psa+++++++ +l +++ ++V++WFqN++a++++
AT5G59340.1 13 SRWNPTKDQITLLENLYKEgIRTPSADQIQQITGRLraygHIEGKNVFYWFQNHKARQRQ 72
8*****************99**************************************97 PP
|
2 | Wus_type_Homeobox | 115.2 | 3.2e-37 | 11 | 74 | 2 | 65 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
+++RW+Pt++Qi++Le+lyk+G+rtP++++iq+it +L++yG+ie+kNVfyWFQN+kaR+rqkq
AT5G59340.1 11 SSSRWNPTKDQITLLENLYKEGIRTPSADQIQQITGRLRAYGHIEGKNVFYWFQNHKARQRQKQ 74
689***********************************************************97 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Wang D,Harper JF,Gribskov M
Systematic trans-genomic comparison of protein kinases between Arabidopsis and Saccharomyces cerevisiae. Plant Physiol., 2003. 132(4): p. 2152-65 [PMID:12913170] - Haecker A, et al.
Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana. Development, 2004. 131(3): p. 657-68 [PMID:14711878] - Sottosanto JB,Gelli A,Blumwald E
DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression. Plant J., 2004. 40(5): p. 752-71 [PMID:15546358] - Wu X,Chory J,Weigel D
Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development. Dev. Biol., 2007. 309(2): p. 306-16 [PMID:17706632] - Breuninger H,Rikirsch E,Hermann M,Ueda M,Laux T
Differential expression of WOX genes mediates apical-basal axis formation in the Arabidopsis embryo. Dev. Cell, 2008. 14(6): p. 867-76 [PMID:18539115] - Gebert M,Dresselhaus T,Sprunck S
F-actin organization and pollen tube tip growth in Arabidopsis are dependent on the gametophyte-specific Armadillo repeat protein ARO1. Plant Cell, 2008. 20(10): p. 2798-814 [PMID:18931021] - Palovaara J,Hakman I
WOX2 and polar auxin transport during spruce embryo pattern formation. Plant Signal Behav, 2009. 4(2): p. 153-5 [PMID:19649198] - Nelson DC, et al.
Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100 [PMID:20351290] - Hirakawa Y,Kondo Y,Fukuda H
TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis. Plant Cell, 2010. 22(8): p. 2618-29 [PMID:20729381] - Zhang X,Zong J,Liu J,Yin J,Zhang D
Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar. J Integr Plant Biol, 2010. 52(11): p. 1016-26 [PMID:20977659] - Ueda M,Zhang Z,Laux T
Transcriptional activation of Arabidopsis axis patterning genes WOX8/9 links zygote polarity to embryo development. Dev. Cell, 2011. 20(2): p. 264-70 [PMID:21316593] - Causier B,Ashworth M,Guo W,Davies B
The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] - Lie C,Kelsom C,Wu X
WOX2 and STIMPY-LIKE/WOX8 promote cotyledon boundary formation in Arabidopsis. Plant J., 2012. 72(4): p. 674-82 [PMID:22827849] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development. Plant Cell Physiol., 2015. 56(9): p. 1855-66 [PMID:26220906] - Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce. BMC Plant Biol., 2016. 16: p. 19 [PMID:26786587] - Zhang Z,Tucker E,Hermann M,Laux T
A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells. Dev. Cell, 2017. 40(3): p. 264-277.e4 [PMID:28171749]
|