![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G57620.1 | ||||||||
Common Name | AtMYB36, MUA2.20, MYB36 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 333aa MW: 37980.4 Da PI: 8.3143 | ||||||||
Description | myb domain protein 36 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.5 | 2.3e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l+d++ ++G+g +W + ++++g++R++k+c++rw++yl AT5G57620.1 14 KGPWSPEEDVKLKDYIDKYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62 79*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 38.5 | 2.7e-12 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +++eEd +++ + G++ W+ Ia+ ++ gRt++++k++w++ AT5G57620.1 69 GGFSEEEDRIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111 569******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.519 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.95E-27 | 11 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-12 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.8E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.1E-24 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.33E-8 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 22.015 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 5.3E-12 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-11 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-23 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.90E-8 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0008285 | Biological Process | negative regulation of cell proliferation | ||||
GO:0035987 | Biological Process | endodermal cell differentiation | ||||
GO:0045597 | Biological Process | positive regulation of cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000021 | Biological Process | regulation of ion homeostasis | ||||
GO:2000067 | Biological Process | regulation of root morphogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0048226 | Cellular Component | Casparian strip | ||||
GO:0000975 | Molecular Function | regulatory region DNA binding | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009005 | anatomy | root | ||||
PO:0020100 | anatomy | hypocotyl |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 333 aa Download sequence Send to blast |
MGRAPCCDKA NVKKGPWSPE EDVKLKDYID KYGTGGNWIA LPQKIGLKRC GKSCRLRWLN 60 YLRPNIKHGG FSEEEDRIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGR 120 QKQMNRQDSI TDSTENNLSN NNNNKSPQNL SNSALERLQL HMQLQNLQSP FSSFYNNPIL 180 WPKLHPLLQS TTTNQNPKLA SQESFHPLGV NVDHQHNNTK LAQINNGASS LYSENVEQSQ 240 NPAHEFQPNF GFSQDLRLDN HNMDFMNRGV SKELFQVGNE FELTNGSSWW SEEVELERKT 300 TSSSSWGSAS VLDQTTEGMV MLQDYAQMSY HSV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-25 | 14 | 117 | 7 | 108 | B-MYB |
1h8a_C | 5e-25 | 14 | 117 | 27 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.7489 | 0.0 | root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 247868_at | 0.0 | ||||
Expression Atlas | AT5G57620 | - | ||||
AtGenExpress | AT5G57620 | - | ||||
ATTED-II | AT5G57620 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In roots, expressed in endodermal cells from the late elongation zones to the differentiation zone and, to a lower extent, in endodermal cells of the meristematic zone. {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves, roots (endodermis-specific) and seedlings. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322, ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a putative transcription factor (MYB36). | |||||
UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G57620.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: In myb36-1, myb36-2 and myb36-4, impaired Casparian strips formation replaced by ectopic lignin-like material in the corners of endodermal cells, associated with reduced expression of several endodermis-specific genes and abnormal CASP1 localization in the plasma membrane (PubMed:26124109, PubMed:26371322). Multiple changes to leaf ionome, including elevated concentrations of sodium, magnesium, and zinc and decreased calcium, manganese, and iron. Longer root hairs (PubMed:26124109). Delayed and defective barrier (Casparian strips) formation as well as extra cell divisions in the meristem in roots (PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G57620 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519640 | 0.0 | AY519640.1 Arabidopsis thaliana MYB transcription factor (At5g57620) mRNA, complete cds. | |||
GenBank | BT030331 | 0.0 | BT030331.1 Arabidopsis thaliana unknown protein (At5g57620) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_200570.1 | 0.0 | myb domain protein 36 | ||||
Swissprot | Q9FKL2 | 0.0 | MYB36_ARATH; Transcription factor MYB36 | ||||
TrEMBL | A0A178UPL3 | 0.0 | A0A178UPL3_ARATH; MYB36 | ||||
STRING | AT5G57620.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7898 | 26 | 39 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G57620.1 |
Entrez Gene | 835866 |
iHOP | AT5G57620 |
wikigenes | AT5G57620 |