PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G51910.2

Common Name

MJM18.6, TCP19

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

TCP

Protein Properties

Length: 293aa MW: 31460.4 Da PI: 7.5477

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G51910.2	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	117.6	1.6e-36	50	122	1	73
TCP 1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 +a+k+ +++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLl+ a+pai+e+tgt++ +a ++ AT5G51910.2 50 PAPKRPTSKDRHTKVEGRGRRIRMPAGCAARVFQLTRELGHKSDGETIRWLLERAEPAIIEATGTGTVPAIAV 122 5899*************************************************************88888444 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	9.4E-30	56	133	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	27.551	57	111	IPR017887	Transcription factor TCP subgroup

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0031347	Biological Process	regulation of defense response
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009052	anatomy	flower pedicel
PO:0020003	anatomy	plant ovule
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 293 aa Download sequence Send to blast
MESNHEGNAI QVIDQVTTMT HLSDPNPKTK PGMMLMKQED GYLQPVKTKP APKRPTSKDR 60 HTKVEGRGRR IRMPAGCAAR VFQLTRELGH KSDGETIRWL LERAEPAIIE ATGTGTVPAI 120 AVSVNGTLKI PTSSPVLNDG GRDGDGDLIK KRRKRNCTSD FVDVNDSCHS SVTSGLAPIT 180 ASNYGVNILN VNTQGFVPFW PMGMGTAFVT GGPDQMGQMW AIPTVATAPF LNVGARPVSS 240 YVSNASDAEA EMETSGGGTT QPLRDFSLEI YDKRELQFLG GSGNSSPSSC HET

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	149	153	KKRRK

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.29652	0.0	flower

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	248385_at	0.0
Expression Atlas	AT5G51910	-
AtGenExpress	AT5G51910	-
ATTED-II	AT5G51910	-

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00064	PBM	25215497	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G51910.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G60970, AT5G62430, AT1G14920, AT1G24625, AT1G30210, AT1G35560, AT1G53230, AT1G58100, AT1G69690
IntAct	Search Q9LT89

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G51910

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB025623	0.0	AB025623.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJM18.
GenBank	AK118579	0.0	AK118579.1 Arabidopsis thaliana At5g51910 mRNA for unknown protein, complete cds, clone: RAFL19-81-E01.
GenBank	BT008779	0.0	BT008779.1 Arabidopsis thaliana At5g51910 mRNA, complete cds.
GenBank	CP002688	0.0	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_200004.1	0.0	TCP family transcription factor
Refseq	NP_851173.1	0.0	TCP family transcription factor
Swissprot	Q9LT89	0.0	TCP19_ARATH; Transcription factor TCP19
TrEMBL	A0A178UCD4	0.0	A0A178UCD4_ARATH; Uncharacterized protein
STRING	AT5G51910.1	0.0	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT5G51910.2
Entrez Gene	835266
iHOP	AT5G51910
wikigenes	AT5G51910

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Vandepoele K,Simillion C,Van de Peer Y Detecting the undetectable: uncovering duplicated segments in Arabidopsis by comparison with rice. Trends Genet., 2002. 18(12): p. 606-8 [PMID:12446138] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Nawy T, et al. Transcriptional profile of the Arabidopsis root quiescent center. Plant Cell, 2005. 17(7): p. 1908-25 [PMID:15937229] Aguilar-Martínez JA,Poza-Carrión C,Cubas P Arabidopsis BRANCHED1 acts as an integrator of branching signals within axillary buds. Plant Cell, 2007. 19(2): p. 458-72 [PMID:17307924] Koo J, et al. A GUS/luciferase fusion reporter for plant gene trapping and for assay of promoter activity with luciferin-dependent control of the reporter protein stability. Plant Cell Physiol., 2007. 48(8): p. 1121-31 [PMID:17597079] Skinner DJ,Gasser CS Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants. BMC Plant Biol., 2009. 9: p. 29 [PMID:19291320] Mukhtar MS, et al. Independently evolved virulence effectors converge onto hubs in a plant immune system network. Science, 2011. 333(6042): p. 596-601 [PMID:21798943] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Danisman S, et al. Analysis of functional redundancies within the Arabidopsis TCP transcription factor family. J. Exp. Bot., 2013. 64(18): p. 5673-85 [PMID:24129704] Mar Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners. Plant Physiol., 2014. 166(2): p. 1022-32 [PMID:25118255] Wang X, et al. TCP transcription factors are critical for the coordinated regulation of isochorismate synthase 1 expression in Arabidopsis thaliana. Plant J., 2015. 82(1): p. 151-62 [PMID:25702611]