PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G47370.1

Common Name

HAT2, MQL5.23

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

HD-ZIP

Protein Properties

Length: 283aa MW: 31727.5 Da PI: 7.8695

Description

Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G47370.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	57.1	3.1e-18	129	183	2	56
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ +++k+q Lee F+++++++ +++ LAkkl+Lt rqV vWFqNrRa+ k AT5G47370.1 129 RKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTK 183 788899***********************************************98 PP
2	HD-ZIP_I/II	120.4	9.4e-39	129	218	1	91
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 +kk+rlsk+q+++LEe+F+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke eLr +l AT5G47370.1 129 RKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLQKEAMELR-TL 218 69*************************************************************************************9.44 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04618	5.0E-23	2	91	IPR006712	HD-ZIP protein, N-terminal
Gene3D	G3DSA:1.10.10.60	1.1E-18	110	186	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.15E-18	114	186	IPR009057	Homeodomain-like
PROSITE profile	PS50071	17.313	125	185	IPR001356	Homeobox domain
SMART	SM00389	6.9E-16	127	189	IPR001356	Homeobox domain
Pfam	PF00046	1.0E-15	129	183	IPR001356	Homeobox domain
CDD	cd00086	2.44E-16	129	186	No hit	No description
PROSITE pattern	PS00027	0	160	183	IPR017970	Homeobox, conserved site
Pfam	PF02183	4.1E-8	185	218	IPR003106	Leucine zipper, homeobox-associated
SMART	SM00340	1.1E-23	185	228	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009641	Biological Process	shade avoidance
GO:0009734	Biological Process	auxin-activated signaling pathway
GO:0009826	Biological Process	unidimensional cell growth
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 283 aa Download sequence Send to blast
MMMGKEDLGL SLSLGFSQNH NPLQMNLNPN SSLSNNLQRL PWNQTFDPTS DLRKIDVNSF 60 PSTVNCEEDT GVSSPNSTIS STISGKRSER EGISGTGVGS GDDHDEITPD RGYSRGTSDE 120 EEDGGETSRK KLRLSKDQSA FLEETFKEHN TLNPKQKLAL AKKLNLTARQ VEVWFQNRRA 180 RTKLKQTEVD CEYLKRCVEK LTEENRRLQK EAMELRTLKL SPQFYGQMTP PTTLIMCPSC 240 ERVGGPSSSN HHHNHRPVSI NPWVACAGQV AHGLNFEALR PRS

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	127	133	SRKKLRL
2	177	185	RRARTKLKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.25127	0.0	flower\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30695164	0.0
Genevisible	248801_at	0.0
Expression Atlas	AT5G47370	-
AtGenExpress	AT5G47370	-
ATTED-II	AT5G47370	-

Functional Description ? help Back to Top
Source	Description
TAIR	homeobox-leucine zipper genes induced by auxin, but not by other phytohormones. Plays opposite roles in the shoot and root tissues in regulating auxin-mediated morphogenesis.
UniProt	Probable transcription factor that plays a role in auxin-mediated morphogenesis. Negatively regulates lateral root elongation. {ECO:0000269\|PubMed:12492842}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00550	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G47370.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By indole-3-acetic acid (IAA). {ECO:0000269\|PubMed:12492842}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	auxin

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G51910
IntAct	Search P46601

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G47370

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF428450	0.0	AF428450.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
GenBank	AJ431183	0.0	AJ431183.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT2 (hat2 gene).
GenBank	AY052324	0.0	AY052324.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
GenBank	AY061904	0.0	AY061904.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_199548.1	0.0	Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein
Swissprot	P46601	0.0	HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBL	A0A178UFY1	0.0	A0A178UFY1_ARATH; HAT2
STRING	AT5G47370.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1563	26	90
Representative plant	OGRP196	16	156

Link Out ? help Back to Top
Phytozome	AT5G47370.1
Entrez Gene	834784
iHOP	AT5G47370
wikigenes	AT5G47370

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Sawa S, et al. The HAT2 gene, a member of the HD-Zip gene family, isolated as an auxin inducible gene by DNA microarray screening, affects auxin response in Arabidopsis. Plant J., 2002. 32(6): p. 1011-22 [PMID:12492842] Zhao Y,Dai X,Blackwell HE,Schreiber SL,Chory J SIR1, an upstream component in auxin signaling identified by chemical genetics. Science, 2003. 301(5636): p. 1107-10 [PMID:12893885] Dal Bosco C, et al. Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Jiao Y, et al. A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development. Plant Physiol., 2003. 133(4): p. 1480-93 [PMID:14605227] Devlin PF,Yanovsky MJ,Kay SA A genomic analysis of the shade avoidance response in Arabidopsis. Plant Physiol., 2003. 133(4): p. 1617-29 [PMID:14645734] Pufky J,Qiu Y,Rao MV,Hurban P,Jones AM The auxin-induced transcriptome for etiolated Arabidopsis seedlings using a structure/function approach. Funct. Integr. Genomics, 2003. 3(4): p. 135-43 [PMID:14648238] Goda H, et al. Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. Plant Physiol., 2004. 134(4): p. 1555-73 [PMID:15047898] Hilson P, et al. Versatile gene-specific sequence tags for Arabidopsis functional genomics: transcript profiling and reverse genetics applications. Genome Res., 2004. 14(10B): p. 2176-89 [PMID:15489341] Wilmoth JC, et al. NPH4/ARF7 and ARF19 promote leaf expansion and auxin-induced lateral root formation. Plant J., 2005. 43(1): p. 118-30 [PMID:15960621] Henriksson E, et al. Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] Vergnolle C, et al. The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions. Plant Physiol., 2005. 139(3): p. 1217-33 [PMID:16258011] Raghavan C,Ong EK,Dalling MJ,Stevenson TW Regulation of genes associated with auxin, ethylene and ABA pathways by 2,4-dichlorophenoxyacetic acid in Arabidopsis. Funct. Integr. Genomics, 2006. 6(1): p. 60-70 [PMID:16317577] Esmon CA, et al. A gradient of auxin and auxin-dependent transcription precedes tropic growth responses. Proc. Natl. Acad. Sci. U.S.A., 2006. 103(1): p. 236-41 [PMID:16371470] Roig-Villanova I,Bou J,Sorin C,Devlin PF,Martínez-García JF Identification of primary target genes of phytochrome signaling. Early transcriptional control during shade avoidance responses in Arabidopsis. Plant Physiol., 2006. 141(1): p. 85-96 [PMID:16565297] Laskowski M,Biller S,Stanley K,Kajstura T,Prusty R Expression profiling of auxin-treated Arabidopsis roots: toward a molecular analysis of lateral root emergence. Plant Cell Physiol., 2006. 47(6): p. 788-92 [PMID:16621846] Town CD, et al. Comparative genomics of Brassica oleracea and Arabidopsis thaliana reveal gene loss, fragmentation, and dispersal after polyploidy. Plant Cell, 2006. 18(6): p. 1348-59 [PMID:16632643] Nemhauser JL,Hong F,Chory J Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses. Cell, 2006. 126(3): p. 467-75 [PMID:16901781] Shin R, et al. The Arabidopsis transcription factor MYB77 modulates auxin signal transduction. Plant Cell, 2007. 19(8): p. 2440-53 [PMID:17675404] Huang D,Wu W,Abrams SR,Cutler AJ The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] Ciarbelli AR, et al. The Arabidopsis homeodomain-leucine zipper II gene family: diversity and redundancy. Plant Mol. Biol., 2008. 68(4-5): p. 465-78 [PMID:18758690] Sorin C,Salla-Martret M,Bou-Torrent J,Roig-Villanova I,Martínez-García JF ATHB4, a regulator of shade avoidance, modulates hormone response in Arabidopsis seedlings. Plant J., 2009. 59(2): p. 266-77 [PMID:19392702] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Bou-Torrent J, et al. ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis. Plant Signal Behav, 2012. 7(11): p. 1382-7 [PMID:22918502] Cruz-Ram A SCARECROW-RETINOBLASTOMA protein network controls protective quiescence in the Arabidopsis root stem cell organizer. PLoS Biol., 2013. 11(11): p. e1001724 [PMID:24302889] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Zou LJ, et al. Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus. Plant Cell Physiol., 2016. 57(9): p. 1879-89 [PMID:27328697] Schena M,Davis RW Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families. Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7 [PMID:7915839]