PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G33210.1 | ||||||||
Common Name | SRS8 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 173aa MW: 19542.7 Da PI: 9.3273 | ||||||||
Description | SHI-related sequence 8 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 123.6 | 2.3e-38 | 46 | 140 | 2 | 96 |
DUF702 2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 +sg++sCqd GnqakkdC+h+RCRtCCksrgf+C+thv+stWvpa+krrerqqqla+ + +++ + e+ +kr+re+ +++s+l +t+++ ++ AT5G33210.1 46 GSGGVSCQDFGNQAKKDCSHMRCRTCCKSRGFECSTHVRSTWVPATKRRERQQQLATVQPQTQLPRGESVPKRHRENLPATSSSLVCTRIPFHSG 140 57899*****************************************************99999999***********************998765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 2.0E-32 | 49 | 127 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 5.2E-26 | 51 | 93 | IPR006510 | Zinc finger, lateral root primordium type 1 |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0009734 | Biological Process | auxin-activated signaling pathway | ||||
GO:0009851 | Biological Process | auxin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MDMNMEKIFE DSVPCRVRAK RGCATHPRSI AERAAMMMIR SGGSGGSGGV SCQDFGNQAK 60 KDCSHMRCRT CCKSRGFECS THVRSTWVPA TKRRERQQQL ATVQPQTQLP RGESVPKRHR 120 ENLPATSSSL VCTRIPFHSG ICHCNVKYLF MCIYICLLLY GREIYNEMQA AFL |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 260079_s_at | 1e-34 | ||||
Expression Atlas | AT5G33210 | - | ||||
AtGenExpress | AT5G33210 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. SRS8 is a putative pseudogene. | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM) (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G33210.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G33210 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB046437 | 0.0 | AB046437.1 Arabidopsis thaliana DNA, chromosome 5 centromere region, clone:F11B20. | |||
GenBank | AC069557 | 0.0 | AC069557.5 Genomic Sequence For Arabidopsis thaliana Clone T29A4 From Chromosome V, complete sequence. | |||
GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_198306.1 | 1e-128 | SHI-related sequence 8 | ||||
Swissprot | F4KH89 | 1e-129 | SRS8_ARATH; Protein SHI RELATED SEQUENCE 8 | ||||
TrEMBL | F4KH88 | 7e-71 | F4KH88_ARATH; SHI-related sequence 8 | ||||
STRING | AT5G33210.1 | 1e-127 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM22621 | 3 | 4 | Representative plant | OGRP1872 | 11 | 40 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G33210.1 |
Entrez Gene | 833279 |
iHOP | AT5G33210 |
wikigenes | AT5G33210 |