PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G35550.1 | ||||||||
Common Name | ATWOX13, F8D20.60, HB-4, WOX13 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 268aa MW: 29672.9 Da PI: 5.3537 | ||||||||
Description | WUSCHEL related homeobox 13 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 64.3 | 1.7e-20 | 97 | 157 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 r+R+t+t+ ql++Le+ F + + +ps++++++++++l ++ e++V++WFqNrRa+ k+ AT4G35550.1 97 RQRWTPTPVQLQILERIFDQgTGTPSKQKIKDITEELsqhgQIAEQNVYNWFQNRRARSKR 157 89*****************99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 103.4 | 1.6e-33 | 96 | 159 | 2 | 65 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 ar+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G+i ++NV++WFQNr+aR+++kq AT4G35550.1 96 ARQRWTPTPVQLQILERIFDQGTGTPSKQKIKDITEELSQHGQIAEQNVYNWFQNRRARSKRKQ 159 789***********************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 7.1E-17 | 92 | 160 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 14.673 | 93 | 158 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 3.89E-17 | 93 | 159 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 5.8E-14 | 95 | 162 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 2.7E-18 | 97 | 157 | IPR001356 | Homeobox domain |
CDD | cd00086 | 2.63E-12 | 97 | 159 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000016 | anatomy | lateral root primordium | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0003011 | anatomy | root vascular system | ||||
PO:0005017 | anatomy | flower vascular system | ||||
PO:0006203 | anatomy | pericycle | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0009062 | anatomy | gynoecium | ||||
PO:0009073 | anatomy | stigma | ||||
PO:0020003 | anatomy | plant ovule | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020130 | anatomy | central root cap | ||||
PO:0020131 | anatomy | lateral root cap | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 268 aa Download sequence Send to blast |
MMEWDNQLQP NNHHSSNLQG IDVNGGSGAG GGMYVKVMTD EQYETLRKQI AIYGTICERL 60 VEMHKTLTAQ QDLAGGRMGG LYADPMMSSL GHKMTARQRW TPTPVQLQIL ERIFDQGTGT 120 PSKQKIKDIT EELSQHGQIA EQNVYNWFQN RRARSKRKQH GGGSSGNNNG ESEVETEVEA 180 LNEKRVVRPE SLLGLPDGNS NNNGLGTTTA TTTAPRPEDL CFQSPEISSD LHLLDVLSNP 240 RDEHLVGKMG LAESYNLYDH VEDYGMSG |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 150 | 158 | RRARSKRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.2408 | 0.0 | flower| leaf| root| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145353584 | 0.0 | ||||
Genevisible | 253131_at | 0.0 | ||||
Expression Atlas | AT4G35550 | - | ||||
AtGenExpress | AT4G35550 | - | ||||
ATTED-II | AT4G35550 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. WOX13 is the only family member that does not contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. | |||||
UniProt | Transcription factor which may be involved in developmental processes. {ECO:0000250}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00617 | PBM | 24477691 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G35550.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G35550 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY048268 | 0.0 | AY048268.1 Arabidopsis thaliana AT4g35550/F8D20_60 mRNA, complete cds. | |||
GenBank | AY251404 | 0.0 | AY251404.1 Arabidopsis thaliana WOX13 protein mRNA, complete cds. | |||
GenBank | BT000538 | 0.0 | BT000538.1 Arabidopsis thaliana homeodomain - like protein (At4g35550/F8D20_60) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_195280.1 | 0.0 | WUSCHEL related homeobox 13 | ||||
Swissprot | O81788 | 0.0 | WOX13_ARATH; WUSCHEL-related homeobox 13 | ||||
TrEMBL | A0A178UZQ1 | 0.0 | A0A178UZQ1_ARATH; WOX13 | ||||
STRING | AT4G35550.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4620 | 28 | 51 | Representative plant | OGRP1873 | 16 | 39 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G35550.1 |
Entrez Gene | 829707 |
iHOP | AT4G35550 |
wikigenes | AT4G35550 |