PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT4G28610.1

Common Name

AtPHR1, PHR1, T5F17.60

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

G2-like

Protein Properties

Length: 409aa MW: 45546.3 Da PI: 6.1215

Description

phosphate starvation response 1

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G28610.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	106.4	1.5e-33	225	279	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 k+r+rWtpeLHe+Fveav++LGGse+AtPk +l++mkv+gLt++hvkSHLQkYR+ AT4G28610.1 225 KARMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYRT 279 68****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	11.291	222	282	IPR017930	Myb domain
SuperFamily	SSF46689	5.91E-17	224	279	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	9.4E-31	224	281	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.5E-24	225	279	IPR006447	Myb domain, plants
Pfam	PF00249	4.5E-9	227	278	IPR001005	SANT/Myb domain
Pfam	PF14379	2.7E-24	313	356	IPR025756	MYB-CC type transcription factor, LHEQLE-containing domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0007623	Biological Process	circadian rhythm
GO:0016036	Biological Process	cellular response to phosphate starvation
GO:0055063	Biological Process	sulfate ion homeostasis
GO:0071486	Biological Process	cellular response to high light intensity
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001016	developmental stage	L mature pollen stage
PO:0001017	developmental stage	M germinated pollen stage
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 409 aa Download sequence Send to blast
MEARPVHRSG SRDLTRTSSI PSTQKPSPVE DSFMRSDNNS QLMSRPLGQT YHLLSSSNGG 60 AVGHICSSSS SGFATNLHYS TMVSHEKQQH YTGSSSNNAV QTPSNNDSAW CHDSLPGGFL 120 DFHETNPAIQ NNCQIEDGGI AAAFDDIQKR SDWHEWADHL ITDDDPLMST NWNDLLLETN 180 SNSDSKDQKT LQIPQPQIVQ QQPSPSVELR PVSTTSSNSN NGTGKARMRW TPELHEAFVE 240 AVNSLGGSER ATPKGVLKIM KVEGLTIYHV KSHLQKYRTA RYRPEPSETG SPERKLTPLE 300 HITSLDLKGG IGITEALRLQ MEVQKQLHEQ LEIQRNLQLR IEEQGKYLQM MFEKQNSGLT 360 KGTASTSDSA AKSEQEDKKT ADSKEVPEEE TRKCEELESP QPKRPKIDN

Sequence ? help Back to Top

Protein Sequence Length: 409 aa Download sequence Send to blast

MEARPVHRSG SRDLTRTSSI PSTQKPSPVE DSFMRSDNNS QLMSRPLGQT YHLLSSSNGG  60
AVGHICSSSS SGFATNLHYS TMVSHEKQQH YTGSSSNNAV QTPSNNDSAW CHDSLPGGFL  120
DFHETNPAIQ NNCQIEDGGI AAAFDDIQKR SDWHEWADHL ITDDDPLMST NWNDLLLETN  180
SNSDSKDQKT LQIPQPQIVQ QQPSPSVELR PVSTTSSNSN NGTGKARMRW TPELHEAFVE  240
AVNSLGGSER ATPKGVLKIM KVEGLTIYHV KSHLQKYRTA RYRPEPSETG SPERKLTPLE  300
HITSLDLKGG IGITEALRLQ MEVQKQLHEQ LEIQRNLQLR IEEQGKYLQM MFEKQNSGLT  360
KGTASTSDSA AKSEQEDKKT ADSKEVPEEE TRKCEELESP QPKRPKIDN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	6e-35	224	283	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	6e-35	224	283	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	6e-35	224	283	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	6e-35	224	283	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	6e-35	224	283	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	6e-35	224	283	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	6e-35	224	283	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	6e-35	224	283	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.4525	0.0	cell culture\| flower\| leaf\| seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30688041	0.0
Genevisible	253784_at	0.0
Expression Atlas	AT4G28610	-
AtGenExpress	AT4G28610	-
ATTED-II	AT4G28610	-

Functional Description ? help Back to Top
Source	Description
TAIR	Similar to phosphate starvation response gene from Chlamydomonas. Weakly responsive to phosphate starvation. Acts upstream of PHO2 in phosphate signaling.
UniProt	Transcription factor involved in phosphate starvation signaling (PubMed:11511543, PubMed:17927693, PubMed:26586833). Binds as a dimer to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:11511543, PubMed:20838596, PubMed:26586833). SPX1 is a competitive inhibitor of this DNA-binding (PubMed:25271326). PHR1 binding to its targets is low Pi-dependent (PubMed:25271326). Regulates the expression of miR399 (PubMed:20838596). Regulates the expression of IPS1 (At3g09922), a non-coding RNA that mimics the target of miR399 to block the cleavage of PHO2 under Pi-deficient conditions (PubMed:17643101). Regulates lipid remodeling and triacylglycerol accumulation during phosphorus starvation (PubMed:25680792). Required for the shoot-specific hypoxic response (PubMed:24753539). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). Contributes to the homeostasis of both sulfate and phosphate in plants under phosphate deficiency (PubMed:21261953). Required for adaptation to high light and retaining functional photosynthesis during phosphate starvation (PubMed:21910737). Involved in the coregulation of Zn and Pi homeostasis (PubMed:24420568). {ECO:0000269\|PubMed:11511543, ECO:0000269\|PubMed:17643101, ECO:0000269\|PubMed:17927693, ECO:0000269\|PubMed:20838596, ECO:0000269\|PubMed:21261953, ECO:0000269\|PubMed:21910737, ECO:0000269\|PubMed:23788639, ECO:0000269\|PubMed:24420568, ECO:0000269\|PubMed:24753539, ECO:0000269\|PubMed:25271326, ECO:0000269\|PubMed:25680792, ECO:0000269\|PubMed:26586833}.

Function -- GeneRIF ? help Back to Top
In darkness, expression of the PHR1 and UVR3 photolyase genes, responsible for photoreactivation, is maintained at a basal level through the positive action of HY5 and HYH photomorphogenesis-promoting transcription factors [PMID: 20487384] PHR1 and PHL1 are partially redundant transcription factors acting as central integrators of phosphate starvation responses. [PMID: 20838596] PHR1 plays an important role in sulfate inter-organ transport. [PMID: 21261953] A variant of the PHR1 binding site is highly enriched in the Arabidopsis phosphate-responsive phospholipase DZ2 coexpression network. [PMID: 22836502] that both PHR1 and PHL1 are major factors involved in the regulation of iron homeostasis [PMID: 23788639] PHR1 and PHO1 participate in the coregulation of Zn and Pi homeostasis. [PMID: 24420568] PHR1 is a key factor for metabolic reprogramming during phosphorus (P) limitation. The effects of pho2 or microRNA399 overexpression were comparatively minor. [PMID: 24894834] The relative strength of the SPX1/PHR1 interaction is thus directly influenced by phosphate (Pi), providing a link between Pi perception and signaling. [PMID: 25271326] PHL2 and PHR1 act redundantly as the key components of the central regulatory system controlling transcriptional responses to phosphate starvation. [PMID: 26586833] AtPHR1, a key transcription factor in Pi homeostasis of plants, was required for the negative regulation function of the AtMyb4 element in shoots. Additionally, the AtSPX3 promoter had a length limitation for activating gene expression. [PMID: 27382128] The results reveal a previously unknown link between Pro metabolism and phosphate nutrition and show that Pro biosynthesis is target of cross talk between Abscisic Acid (ABA) signaling and regulation of phosphate homeostasis through PHR1- and PHL1-mediated transcriptional activation of the P5CS1 gene. [PMID: 28765275] light and ethylene coordinately regulate PHR1 expression and Phosphate starvation responses through signaling convergence at the PHR1 promoter. [PMID: 28842534] These data suggest that, in the Pi-restored condition, AtSPX1 can bind to monomeric AtPHR1 in solution and therefore regulate PSI gene expression by tuning the AtPHR1-DNA-binding equilibrium. [PMID: 28887383] Transcription factors AUXIN RESPONSE FACTOR7 (ARF7) and ARF19 mutants showed down-regulated expression of PHOSPHATE STARVATION RESPONSE1 (PHR1) and downstream Pi starvation-induced genes in roots. [PMID: 30026290]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G28610.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Only moderately up-regulated by Pi starvation. {ECO:0000269\|PubMed:11511543}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT2G02990(A), AT2G33770(R), AT2G45130(A), AT3G09922(A), AT3G23430(A), AT3G52190(A), AT5G20150(R), AT5G24770(A)

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Strongly reduced shoot growth, and slightly increased root growth. Reduced expression of phosphate starvation-induced (PSI) genes, decreased cellular inorganic phosphate (Pi) content and shoot-to-root ratio, and impaired anthocyanin accumulation (PubMed:17927693). {ECO:0000269\|PubMed:17927693}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G28610

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ310799	0.0	AJ310799.1 Arabidopsis thaliana mRNA for phosphate starvation response regulator 1 (phr1 gene).
GenBank	JN009802	0.0	JN009802.1 UNVERIFIED: Lupinus polyphyllus phosphate starvation response regulator-like mRNA, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_194590.2	0.0	phosphate starvation response 1
Swissprot	Q94CL7	0.0	PHR1_ARATH; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBL	A0A178UXC9	0.0	A0A178UXC9_ARATH; PHR1
STRING	AT4G28610.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM856	27	117
Representative plant	OGRP78	17	262

Link Out ? help Back to Top
Phytozome	AT4G28610.1
Entrez Gene	828979
iHOP	AT4G28610
wikigenes	AT4G28610

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Rubio V, et al. A conserved MYB transcription factor involved in phosphate starvation signaling both in vascular plants and in unicellular algae. Genes Dev., 2001. 15(16): p. 2122-33 [PMID:11511543] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Franco-Zorrilla JM, et al. The transcriptional control of plant responses to phosphate limitation. J. Exp. Bot., 2004. 55(396): p. 285-93 [PMID:14718495] Miura K, et al. The Arabidopsis SUMO E3 ligase SIZ1 controls phosphate deficiency responses. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(21): p. 7760-5 [PMID:15894620] Liu Y, et al. Arabidopsis vegetative storage protein is an anti-insect acid phosphatase. Plant Physiol., 2005. 139(3): p. 1545-56 [PMID:16258019] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Gonz PHOSPHATE TRANSPORTER TRAFFIC FACILITATOR1 is a plant-specific SEC12-related protein that enables the endoplasmic reticulum exit of a high-affinity phosphate transporter in Arabidopsis. Plant Cell, 2005. 17(12): p. 3500-12 [PMID:16284308] Bari R,Datt Pant B,Stitt M,Scheible WR PHO2, microRNA399, and PHR1 define a phosphate-signaling pathway in plants. Plant Physiol., 2006. 141(3): p. 988-99 [PMID:16679424] K Tissue-specific expression of tomato Ribonuclease LX during phosphate starvation-induced root growth. J. Exp. Bot., 2006. 57(14): p. 3717-26 [PMID:16990375] M Genome-wide analysis of the Arabidopsis leaf transcriptome reveals interaction of phosphate and sugar metabolism. Plant Physiol., 2007. 143(1): p. 156-71 [PMID:17085508] Stefanovic A, et al. Members of the PHO1 gene family show limited functional redundancy in phosphate transfer to the shoot, and are regulated by phosphate deficiency via distinct pathways. Plant J., 2007. 50(6): p. 982-94 [PMID:17461783] Franco-Zorrilla JM, et al. Target mimicry provides a new mechanism for regulation of microRNA activity. Nat. Genet., 2007. 39(8): p. 1033-7 [PMID:17643101] Nilsson L,M Increased expression of the MYB-related transcription factor, PHR1, leads to enhanced phosphate uptake in Arabidopsis thaliana. Plant Cell Environ., 2007. 30(12): p. 1499-512 [PMID:17927693] Ribot C,Wang Y,Poirier Y Expression analyses of three members of the AtPHO1 family reveal differential interactions between signaling pathways involved in phosphate deficiency and the responses to auxin, cytokinin, and abscisic acid. Planta, 2008. 227(5): p. 1025-36 [PMID:18094993] Zhou J, et al. OsPHR2 is involved in phosphate-starvation signaling and excessive phosphate accumulation in shoots of plants. Plant Physiol., 2008. 146(4): p. 1673-86 [PMID:18263782] Duan K, et al. Characterization of a sub-family of Arabidopsis genes with the SPX domain reveals their diverse functions in plant tolerance to phosphorus starvation. Plant J., 2008. 54(6): p. 965-75 [PMID:18315545] Gaude N,Nakamura Y,Scheible WR,Ohta H,D Phospholipase C5 (NPC5) is involved in galactolipid accumulation during phosphate limitation in leaves of Arabidopsis. Plant J., 2008. 56(1): p. 28-39 [PMID:18564386] Vald Essential role of MYB transcription factor: PvPHR1 and microRNA: PvmiR399 in phosphorus-deficiency signalling in common bean roots. Plant Cell Environ., 2008. 31(12): p. 1834-43 [PMID:18771575] Grennan AK Phosphate accumulation in plants: signaling. Plant Physiol., 2008. 148(1): p. 3-5 [PMID:18772350] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Vald Transcriptional regulation and signaling in phosphorus starvation: what about legumes? J Integr Plant Biol, 2008. 50(10): p. 1213-22 [PMID:19017108] Jones AM, et al. Phosphoproteomic analysis of nuclei-enriched fractions from Arabidopsis thaliana. J Proteomics, 2009. 72(3): p. 439-51 [PMID:19245862] Reiland S, et al. Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks. Plant Physiol., 2009. 150(2): p. 889-903 [PMID:19376835] Wu P,Wang X Role of OsPHR2 on phosphorus homeostasis and root hairs development in rice (Oryza sativa L.). Plant Signal Behav, 2008. 3(9): p. 674-5 [PMID:19704822] Lundmark M,K Global analysis of microRNA in Arabidopsis in response to phosphate starvation as studied by locked nucleic acid-based microarrays. Physiol Plant, 2010. 140(1): p. 57-68 [PMID:20487378] Castells E, et al. det1-1-induced UV-C hyposensitivity through UVR3 and PHR1 photolyase gene over-expression. Plant J., 2010. 63(3): p. 392-404 [PMID:20487384] Bustos R, et al. A central regulatory system largely controls transcriptional activation and repression responses to phosphate starvation in Arabidopsis. PLoS Genet., 2010. 6(9): p. e1001102 [PMID:20838596] Thibaud MC, et al. Dissection of local and systemic transcriptional responses to phosphate starvation in Arabidopsis. Plant J., 2010. 64(5): p. 775-89 [PMID:21105925] Rouached H,Secco D,Arpat B,Poirier Y The transcription factor PHR1 plays a key role in the regulation of sulfate shoot-to-root flux upon phosphate starvation in Arabidopsis. BMC Plant Biol., 2011. 11: p. 19 [PMID:21261953] Li G, et al. Coordinated transcriptional regulation underlying the circadian clock in Arabidopsis. Nat. Cell Biol., 2011. 13(5): p. 616-22 [PMID:21499259] Castrillo G, et al. Speeding cis-trans regulation discovery by phylogenomic analyses coupled with screenings of an arrayed library of Arabidopsis transcription factors. PLoS ONE, 2011. 6(6): p. e21524 [PMID:21738689] Nilsson L,Lundmark M,Jensen PE,Nielsen TH The Arabidopsis transcription factor PHR1 is essential for adaptation to high light and retaining functional photosynthesis during phosphate starvation. Physiol Plant, 2012. 144(1): p. 35-47 [PMID:21910737] Oropeza-Aburto A, et al. Functional analysis of the Arabidopsis PLDZ2 promoter reveals an evolutionarily conserved low-Pi-responsive transcriptional enhancer element. J. Exp. Bot., 2012. 63(5): p. 2189-202 [PMID:22210906] Acevedo-Hern A specific variant of the PHR1 binding site is highly enriched in the Arabidopsis phosphate-responsive phospholipase DZ2 coexpression network. Plant Signal Behav, 2012. 7(8): p. 914-7 [PMID:22836502] Jain A,Nagarajan VK,Raghothama KG Transcriptional regulation of phosphate acquisition by higher plants. Cell. Mol. Life Sci., 2012. 69(19): p. 3207-24 [PMID:22899310] Wang J, et al. A phosphate starvation response regulator Ta-PHR1 is involved in phosphate signalling and increases grain yield in wheat. Ann. Bot., 2013. 111(6): p. 1139-53 [PMID:23589634] Bournier M, et al. Arabidopsis ferritin 1 (AtFer1) gene regulation by the phosphate starvation response 1 (AtPHR1) transcription factor reveals a direct molecular link between iron and phosphate homeostasis. J. Biol. Chem., 2013. 288(31): p. 22670-80 [PMID:23788639] Matsui K,Togami J,Mason JG,Chandler SF,Tanaka Y Enhancement of phosphate absorption by garden plants by genetic engineering: a new tool for phytoremediation. Biomed Res Int, 2013. 2013: p. 182032 [PMID:23984322] Khan GA, et al. Coordination between zinc and phosphate homeostasis involves the transcription factor PHR1, the phosphate exporter PHO1, and its homologue PHO1;H3 in Arabidopsis. J. Exp. Bot., 2014. 65(3): p. 871-84 [PMID:24420568] Klecker M, et al. A Shoot-Specific Hypoxic Response of Arabidopsis Sheds Light on the Role of the Phosphate-Responsive Transcription Factor PHOSPHATE STARVATION RESPONSE1. Plant Physiol., 2014. 165(2): p. 774-790 [PMID:24753539] Pant BD, et al. Identification of primary and secondary metabolites with phosphorus status-dependent abundance in Arabidopsis, and of the transcription factor PHR1 as a major regulator of metabolic changes during phosphorus limitation. Plant Cell Environ., 2015. 38(1): p. 172-87 [PMID:24894834] Puga MI, et al. SPX1 is a phosphate-dependent inhibitor of Phosphate Starvation Response 1 in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2014. 111(41): p. 14947-52 [PMID:25271326] Pant BD, et al. The transcription factor PHR1 regulates lipid remodeling and triacylglycerol accumulation in Arabidopsis thaliana during phosphorus starvation. J. Exp. Bot., 2015. 66(7): p. 1907-18 [PMID:25680792] Jost R, et al. Differentiating phosphate-dependent and phosphate-independent systemic phosphate-starvation response networks in Arabidopsis thaliana through the application of phosphite. J. Exp. Bot., 2015. 66(9): p. 2501-14 [PMID:25697796] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Zhou Z, et al. SPX proteins regulate Pi homeostasis and signaling in different subcellular level. Plant Signal Behav, 2015. 10(9): p. e1061163 [PMID:26224365] Bonnot C, et al. A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana. New Phytol., 2016. 209(1): p. 161-76 [PMID:26243630] Sun L,Song L,Zhang Y,Zheng Z,Liu D Arabidopsis PHL2 and PHR1 Act Redundantly as the Key Components of the Central Regulatory System Controlling Transcriptional Responses to Phosphate Starvation. Plant Physiol., 2016. 170(1): p. 499-514 [PMID:26586833] Khan GA,Vogiatzaki E,Glauser G,Poirier Y Phosphate Deficiency Induces the Jasmonate Pathway and Enhances Resistance to Insect Herbivory. Plant Physiol., 2016. 171(1): p. 632-44 [PMID:27016448] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Yong-Villalobos L, et al. Phosphate starvation induces DNA methylation in the vicinity of cis-acting elements known to regulate the expression of phosphate-responsive genes. Plant Signal Behav, 2016. 11(5): p. e1173300 [PMID:27185363] Li Y,Wu H,Fan H,Zhao T,Ling HQ Characterization of the AtSPX3 Promoter Elucidates its Complex Regulation in Response to Phosphorus Deficiency. Plant Cell Physiol., 2016. 57(8): p. 1767-78 [PMID:27382128] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Yuan J, et al. Systematic characterization of novel lncRNAs responding to phosphate starvation in Arabidopsis thaliana. BMC Genomics, 2016. 17: p. 655 [PMID:27538394] Linn J, et al. Root Cell-Specific Regulators of Phosphate-Dependent Growth. Plant Physiol., 2017. 174(3): p. 1969-1989 [PMID:28465462] Aleksza D,Horváth GV,Sándor G,Szabados L Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation. Plant Physiol., 2017. 175(1): p. 555-567 [PMID:28765275] Liu Y, et al. Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1. Plant Cell, 2017. 29(9): p. 2269-2284 [PMID:28842534] Qi W,Manfield IW,Muench SP,Baker A AtSPX1 affects the AtPHR1-DNA-binding equilibrium by binding monomeric AtPHR1 in solution. Biochem. J., 2017. 474(21): p. 3675-3687 [PMID:28887383] Huang KL, et al. The ARF7 and ARF19 Transcription Factors Positively Regulate PHOSPHATE STARVATION RESPONSE1 in Arabidopsis Roots. Plant Physiol., 2018. 178(1): p. 413-427 [PMID:30026290] Jiang M, et al. Structural basis for the Target DNA recognition and binding by the MYB domain of phosphate starvation response 1. FEBS J., 2019. [PMID:30974511]