Signature Domain? help Back to Top |
![Signature Domain](draw_signature_domain.php?sp=Ath&pid=AT4G24020.1) |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | RWP-RK | 91.9 | 4.9e-29 | 589 | 639 | 2 | 52 |
RWP-RK 2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
ek+isl++l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
AT4G24020.1 589 EKTISLDVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 639
799**********************************************97 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Menges M,Hennig L,Gruissem W,Murray JA
Cell cycle-regulated gene expression in Arabidopsis. J. Biol. Chem., 2002. 277(44): p. 41987-2002 [PMID:12169696] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Scheible WR, et al.
Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] - Schauser L,Wieloch W,Stougaard J
Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus. J. Mol. Evol., 2005. 60(2): p. 229-37 [PMID:15785851] - Castaings L, et al.
The nodule inception-like protein 7 modulates nitrate sensing and metabolism in Arabidopsis. Plant J., 2009. 57(3): p. 426-35 [PMID:18826430] - Wang R,Xing X,Wang Y,Tran A,Crawford NM
A genetic screen for nitrate regulatory mutants captures the nitrate transporter gene NRT1.1. Plant Physiol., 2009. 151(1): p. 472-8 [PMID:19633234] - Hachiya T, et al.
Evidence for a nitrate-independent function of the nitrate sensor NRT1.1 in Arabidopsis thaliana. J. Plant Res., 2011. 124(3): p. 425-30 [PMID:21052766] - Konishi M,Yanagisawa S
Arabidopsis NIN-like transcription factors have a central role in nitrate signalling. Nat Commun, 2013. 4: p. 1617 [PMID:23511481] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Xu N, et al.
The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators. Plant Cell, 2016. 28(2): p. 485-504 [PMID:26744214] - Karve R,Suárez-Román F,Iyer-Pascuzzi AS
The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release. Plant Physiol., 2016. 171(3): p. 2101-11 [PMID:27221617] - Yu LH, et al.
Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation. Sci Rep, 2016. 6: p. 27795 [PMID:27293103] - Menz J,Li Z,Schulze WX,Ludewig U
Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition. Plant J., 2016. 88(5): p. 717-734 [PMID:27419465] - Yan D, et al.
NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis. Nat Commun, 2016. 7: p. 13179 [PMID:27731416] - Guan P, et al.
Interacting TCP and NLP transcription factors control plant responses to nitrate availability. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424 [PMID:28202720] - Liu KH, et al.
Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks. Nature, 2017. 545(7654): p. 311-316 [PMID:28489820] - Li Z, et al.
The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1. New Phytol., 2017. 216(4): p. 1205-1222 [PMID:28850721] - Cao H, et al.
Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation. Front Plant Sci, 2017. 8: p. 1703 [PMID:29051766] - Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis. Microbes Environ., 2017. 32(4): p. 314-323 [PMID:29187692] - Karve RA,Iyer-Pascuzzi AS
Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release. Plant Signal Behav, 2018. 13(1): p. e1414122 [PMID:29215953] - Zhao L, et al.
The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium. Sci Rep, 2018. 8(1): p. 1487 [PMID:29367694]
|