PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G17980.1 | ||||||||
Common Name | anac071, NAC071 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 262aa MW: 30122.1 Da PI: 8.3752 | ||||||||
Description | NAC domain containing protein 71 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 168.9 | 1.7e-52 | 6 | 135 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 lppGfrFhPtdeel+ +yL +k+eg ++el evi+ +d+yk++Pw+Lp k + +++ ew+fF++rdkkya+g+r+nratk+gyWkatgkd+++++k AT4G17980.1 6 LPPGFRFHPTDEELIGYYLSRKIEGLEIEL-EVIPVIDLYKFDPWELPgKsFLPNRDLEWFFFCPRDKKYANGSRTNRATKAGYWKATGKDRKITCKs 102 79****************************.99***************6434455677**************************************94 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ g +ktLvfy+grap g +t+W+mheyrl AT4G17980.1 103 SHVIAGYRKTLVFYEGRAPLGDRTNWFMHEYRL 135 45558**************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.01E-59 | 3 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.712 | 6 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.6E-29 | 7 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0008283 | Biological Process | cell proliferation | ||||
GO:0071365 | Biological Process | cellular response to auxin stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 262 aa Download sequence Send to blast |
MGSSCLPPGF RFHPTDEELI GYYLSRKIEG LEIELEVIPV IDLYKFDPWE LPGKSFLPNR 60 DLEWFFFCPR DKKYANGSRT NRATKAGYWK ATGKDRKITC KSSHVIAGYR KTLVFYEGRA 120 PLGDRTNWFM HEYRLCDIDD HSQKSPNFKG AFALCRVVKK NELKKNSKSL KNKNEQDIGS 180 CYSSLATSPC RDEASQIQSF KPSSTTNDSS SIWISPDFIL DSSKDYPQIK EVASECFPNY 240 HFPVTTANHH VEFPLQEMLV RS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-50 | 6 | 161 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-50 | 6 | 161 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-50 | 6 | 161 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-50 | 6 | 161 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-50 | 6 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swm_B | 3e-50 | 6 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swm_C | 3e-50 | 6 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swm_D | 3e-50 | 6 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swp_A | 3e-50 | 6 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swp_B | 3e-50 | 6 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swp_C | 3e-50 | 6 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swp_D | 3e-50 | 6 | 161 | 20 | 169 | NAC domain-containing protein 19 |
4dul_A | 3e-50 | 6 | 161 | 17 | 166 | NAC domain-containing protein 19 |
4dul_B | 3e-50 | 6 | 161 | 17 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.32955 | 0.0 | cell culture |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 18415001 | 0.0 | ||||
Genevisible | 254698_at | 0.0 | ||||
Expression Atlas | AT4G17980 | - | ||||
AtGenExpress | AT4G17980 | - | ||||
ATTED-II | AT4G17980 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00439 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G17980.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G17980 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AL021889 | 1e-162 | AL021889.2 Arabidopsis thaliana DNA chromosome 4, BAC clone T6K21 (ESSA project). | |||
GenBank | AL161547 | 1e-162 | AL161547.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 47. | |||
GenBank | CP002687 | 1e-162 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_193532.1 | 0.0 | NAC domain containing protein 71 | ||||
Swissprot | O49697 | 0.0 | NAC71_ARATH; NAC domain-containing protein 71 | ||||
TrEMBL | A0A1L7NZ99 | 0.0 | A0A1L7NZ99_ARATH; NAC domain containing protein 71 | ||||
STRING | AT4G17980.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2151 | 27 | 77 | Representative plant | OGRP17 | 15 | 800 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G17980.1 |
Entrez Gene | 827523 |
iHOP | AT4G17980 |
wikigenes | AT4G17980 |