PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G01680.3 | ||||||||
Common Name | AtMYB55, MYB55 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 241aa MW: 27359 Da PI: 9.4427 | ||||||||
Description | myb domain protein 55 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.7 | 2.7e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l+++++++G g+W+++++ g+ R++k+c++rw +yl AT4G01680.3 14 KGLWSPEEDEKLLRYITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 46.4 | 9.3e-15 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++ AT4G01680.3 67 RGAFSQDEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110 89********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-28 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.666 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.12E-30 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.15E-12 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.1E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.799 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.1E-13 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.60E-9 | 69 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 241 aa Download sequence Send to blast |
MGRHSCCYKQ KLRKGLWSPE EDEKLLRYIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY 60 LRPDLKRGAF SQDEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRLRG 120 IDPVTHKLLT EIETGTDDKT KPVEKSQQTY LVETDGSSST TTCSTNQNNN TDHLYTGNFG 180 FQRLSLENGS RIAAGSDLGI WIPQTGRNHH HHVDETIPSA VSISKFKRVT TTIQHSLEMG 240 I |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-30 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145339899 | 0.0 | ||||
Genevisible | 255538_at | 1e-129 | ||||
Expression Atlas | AT4G01680 | - | ||||
AtGenExpress | AT4G01680 | - | ||||
ATTED-II | AT4G01680 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed specifically in guard cells (PubMed:16005292). Expressed in sink tissues, such as xylem, roots and developing seeds (PubMed:22708996). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:22708996}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a putative transcription factor (MYB55). | |||||
UniProt | Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00427 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G01680.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G01680 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF176000 | 0.0 | AF176000.2 Arabidopsis thaliana putative transcription factor (MYB55) mRNA, complete cds. | |||
GenBank | AY054575 | 0.0 | AY054575.1 Arabidopsis thaliana Unknown protein (At4g01680; T15B16.4) mRNA, complete cds. | |||
GenBank | BT000352 | 0.0 | BT000352.1 Arabidopsis thaliana Unknown protein (At4g01680) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001118913.1 | 0.0 | myb domain protein 55 | ||||
Swissprot | Q8VZQ2 | 1e-86 | MYB61_ARATH; Transcription factor MYB61 | ||||
TrEMBL | B3H664 | 1e-180 | B3H664_ARATH; Myb domain protein 55 | ||||
STRING | XP_010422696.1 | 1e-155 | (Camelina sativa) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G01680.3 |
Entrez Gene | 826853 |
iHOP | AT4G01680 |
wikigenes | AT4G01680 |