PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G00270.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | GeBP | ||||||||
Protein Properties | Length: 302aa MW: 34058 Da PI: 6.0323 | ||||||||
Description | DNA-binding storekeeper protein-related transcriptional regulator | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF573 | 115.3 | 3.5e-36 | 64 | 159 | 3 | 98 |
DUF573 3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 + r+w+eeDe+++L+Gl+d++aktg +p+ d+daf++f+ +si ++sk+q+++Kir+LK++f+ +++k+++g++p+f++++d+++f++s++iWg+ AT4G00270.1 64 IVRIWNEEDELSILKGLVDYRAKTGFNPKIDWDAFCSFLGSSIVERFSKDQVLSKIRKLKRRFHVHSEKINQGNDPKFTRSSDSEAFGFSSMIWGQ 159 68********************************************************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04504 | 1.5E-27 | 65 | 158 | IPR007592 | Protein of unknown function DUF573 |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 302 aa Download sequence Send to blast |
MVTPKQIDFS SCVGADNSNG TLSHRRSPRN IPSSKRAASV AEEETMKKKM KMKKKKKKLD 60 PPLIVRIWNE EDELSILKGL VDYRAKTGFN PKIDWDAFCS FLGSSIVERF SKDQVLSKIR 120 KLKRRFHVHS EKINQGNDPK FTRSSDSEAF GFSSMIWGQG DDDGMDKEHE VNGNGAAENR 180 TNESGEEMLK EHEEEVANTE LLNENGAAKT TENGTSSGKE RHDEDNDDDD ELCAVQDAFE 240 AVMSQGLSGY QKKLQLEKLM NLGNGKRREL SDEWKALCVE ETRFNIKKLR FSAKLAEAAN 300 DS |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.28698 | 0.0 | flower| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145339841 | 0.0 | ||||
Genevisible | 265908_at | 0.0 | ||||
Expression Atlas | AT4G00270 | - | ||||
AtGenExpress | AT4G00270 | - | ||||
ATTED-II | AT4G00270 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the apical meristem and young leaf primordia (PubMed:12535344, PubMed:18162594). Not detected in emerging or mature leaves (PubMed:12535344). Detected in the vascular tissues of cotyledons and leaves, in hydathodes and at the base of flowers and siliques, but not in roots (PubMed:18162594). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:18162594}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein, which specifically recognizes the GL1 enhancer sequence (PubMed:12535344). May be involved in leaf initiation (PubMed:12535344). May play redundant roles with GPL1 and GPL2 in cytokinin responses by regulating the transcript levels of type-A ARR response genes (PubMed:18162594). Involved in stress responses (PubMed:21875893). Plays a repressive role in cell expansion by counteracting the positive role of CPR5 in this process, but does not regulate cell proliferation or endoreduplication (PubMed:21875893). May play a role in plant defense (PubMed:29192025). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:21875893, ECO:0000269|PubMed:29192025, ECO:0000305|PubMed:18162594}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00061 | PBM | 25215497 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G00270.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by KNAT1. Not regulated by gibberellins. {ECO:0000269|PubMed:12535344}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT4G00270, AT5G14280 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G00270 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF361590 | 0.0 | AF361590.1 Arabidopsis thaliana AT4g00270/A_IG005I10_11 mRNA, complete cds. | |||
GenBank | AY074837 | 0.0 | AY074837.1 Arabidopsis thaliana AT4g00270/A_IG005I10_11 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_567163.1 | 0.0 | DNA-binding storekeeper protein-related transcriptional regulator | ||||
Swissprot | Q9ASZ1 | 0.0 | STKLO_ARATH; GLABROUS1 enhancer-binding protein | ||||
TrEMBL | A0A178UT32 | 0.0 | A0A178UT32_ARATH; Uncharacterized protein | ||||
STRING | AT4G00270.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6117 | 17 | 41 | Representative plant | OGRP4222 | 5 | 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G00270.1 |
Entrez Gene | 827164 |
iHOP | AT4G00270 |
wikigenes | AT4G00270 |