PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G44350.2 | ||||||||
Common Name | anac061, NAC061 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 241aa MW: 26924.3 Da PI: 8.6371 | ||||||||
Description | NAC domain containing protein 61 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 128.6 | 4.8e-40 | 6 | 136 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 +GfrF Pt+ el+++yL+ ++ g + ++++ i+ +d+++veP +Lp+ +++++ ++w fF++r++++a+g r++r+t sgyWkatg+ +v+s AT3G44350.2 6 SVGFRFYPTEVELLTYYLRIQLGGGNATIHSLIPILDVFSVEPTQLPNlageRCRGDAEQWIFFVPRQEREARGGRPSRTTGSGYWKATGSPGPVFSP 103 68***************************999**************9656766667888*************************************** PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++++g+kkt+vfy+g+ap+g+kt+W m+ey++ AT3G44350.2 104 DNRVIGVKKTMVFYTGKAPTGRKTKWKMNEYKA 136 *******************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.62E-43 | 4 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 45.595 | 5 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.7E-19 | 7 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009047 | anatomy | stem | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 241 aa Download sequence Send to blast |
MGEELSVGFR FYPTEVELLT YYLRIQLGGG NATIHSLIPI LDVFSVEPTQ LPNLAGERCR 60 GDAEQWIFFV PRQEREARGG RPSRTTGSGY WKATGSPGPV FSPDNRVIGV KKTMVFYTGK 120 APTGRKTKWK MNEYKAVETA SVSTIPKLRP EFSICRIYIK SGSSRAFDRR PTEAYAIERN 180 LPSNGVETSS RATISTSPET SHSGGNQVDL PVNATTITQS ISDMVDELSQ PFWEWEQMNW 240 S |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-34 | 5 | 165 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-34 | 5 | 165 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-34 | 5 | 165 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-34 | 5 | 165 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-34 | 5 | 165 | 20 | 173 | NAC domain-containing protein 19 |
3swm_B | 6e-34 | 5 | 165 | 20 | 173 | NAC domain-containing protein 19 |
3swm_C | 6e-34 | 5 | 165 | 20 | 173 | NAC domain-containing protein 19 |
3swm_D | 6e-34 | 5 | 165 | 20 | 173 | NAC domain-containing protein 19 |
3swp_A | 6e-34 | 5 | 165 | 20 | 173 | NAC domain-containing protein 19 |
3swp_B | 6e-34 | 5 | 165 | 20 | 173 | NAC domain-containing protein 19 |
3swp_C | 6e-34 | 5 | 165 | 20 | 173 | NAC domain-containing protein 19 |
3swp_D | 6e-34 | 5 | 165 | 20 | 173 | NAC domain-containing protein 19 |
4dul_A | 5e-34 | 5 | 165 | 17 | 170 | NAC domain-containing protein 19 |
4dul_B | 5e-34 | 5 | 165 | 17 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.49394 | 0.0 | leaf |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 252681_at | 0.0 | ||||
Expression Atlas | AT3G44350 | - | ||||
AtGenExpress | AT3G44350 | - | ||||
ATTED-II | AT3G44350 | - |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G44350.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G44350 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AL138641 | 1e-159 | AL138641.2 Arabidopsis thaliana DNA chromosome 3, BAC clone T22K7. | |||
GenBank | CP002686 | 1e-159 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001118771.1 | 1e-179 | NAC domain containing protein 61 | ||||
Swissprot | Q9M290 | 1e-166 | NAC61_ARATH; Putative NAC domain-containing protein 61 | ||||
TrEMBL | B3H506 | 1e-178 | B3H506_ARATH; NAC domain containing protein 61 | ||||
STRING | AT3G44350.2 | 1e-178 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1445 | 28 | 93 | Representative plant | OGRP2278 | 11 | 36 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G44350.2 |
Entrez Gene | 823560 |
iHOP | AT3G44350 |
wikigenes | AT3G44350 |
Publications ? help Back to Top | |||
---|---|---|---|
|