![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G15510.1 | ||||||||
Common Name | ANAC056, ATNAC2, MJK13.17, NAC056, NAC2, NARS1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 364aa MW: 40026.8 Da PI: 7.7448 | ||||||||
Description | NAC domain containing protein 2 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 172.9 | 9.7e-54 | 17 | 144 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrFhPtdeelvv+yLk+k+++ +l++ +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ ++ AT3G15510.1 17 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-AIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLASdGN 113 79****************************.88***************999999***************************************99677 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 ++vg+kk Lvfy+g+ pkg+k+dW+mheyrl AT3G15510.1 114 QKVGVKKALVFYSGKPPKGVKSDWIMHEYRL 144 88***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.53E-65 | 12 | 178 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 62.123 | 17 | 178 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.4E-28 | 18 | 144 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0045995 | Biological Process | regulation of embryonic development | ||||
GO:0048317 | Biological Process | seed morphogenesis | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009005 | anatomy | root | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 364 aa Download sequence Send to blast |
MESTDSSGGP PPPQPNLPPG FRFHPTDEEL VVHYLKRKAA SAPLPVAIIA EVDLYKFDPW 60 ELPAKASFGE QEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVLAS DGNQKVGVKK 120 ALVFYSGKPP KGVKSDWIMH EYRLIENKPN NRPPGCDFGN KKNSLRLDDW VLCRIYKKNN 180 ASRHVDNDKD HDMIDYIFRK IPPSLSMAAA STGLHQHHHN VSRSMNFFPG KFSGGGYGIF 240 SDGGNTSIYD GGGMINNIGT DSVDHDNNAD VVGLNHASSS GPMMMANLKR TLPVPYWPVA 300 DEEQDASPSK RFHGVGGGGG DCSNMSSSMM EETPPLMQQQ GGVLGDGLFR TTSYQLPGLN 360 WYSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-75 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-75 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-75 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-75 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
4dul_A | 8e-75 | 11 | 183 | 11 | 170 | NAC domain-containing protein 19 |
4dul_B | 8e-75 | 11 | 183 | 11 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.10489 | 0.0 | seed| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 258385_at | 0.0 | ||||
Expression Atlas | AT3G15510 | - | ||||
AtGenExpress | AT3G15510 | - | ||||
ATTED-II | AT3G15510 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed throughout anthers from stages 8 to 12. Later confined to distal region of anthers from stage 13. {ECO:0000269|PubMed:16055634}. | |||||
Uniprot | TISSUE SPECIFICITY: Stamen specific, in anthers from stage 8 (PubMed:15100403, PubMed:16055634). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269|PubMed:15100403, ECO:0000269|PubMed:16055634, ECO:0000269|PubMed:18849494}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Note of caution: not to be confused with another protein (AtNAC6 locus AT5G39610) which on occasion has also been referred to as AtNAC2. | |||||
UniProt | Transcription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00361 | DAP | 27203113 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G15510.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT1G11840(A), AT4G33150(R) |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT1G14920 |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: When associated with disruption in NAC018/NARS2, abnormally shaped seeds, defect in embryogenesis sometimes arrested at the torpedo-shaped embryo stage thus leading to partial embryonic lethality, markedly delayed integuments degeneration, and delay of silique senescence. {ECO:0000269|PubMed:18849494}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G15510 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB049071 | 0.0 | AB049071.1 Arabidopsis thaliana AtNAC2 mRNA, complete cds. | |||
GenBank | BT004079 | 0.0 | BT004079.1 Arabidopsis thaliana clone RAFL15-22-L08 (R20756) putative jasmonic acid regulatory protein (At3g15510) mRNA, complete cds. | |||
GenBank | BT005044 | 0.0 | BT005044.1 Arabidopsis thaliana clone U20756 putative jasmonic acid regulatory protein (At3g15510) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_188170.1 | 0.0 | NAC domain containing protein 2 | ||||
Swissprot | Q9LD44 | 0.0 | NAC56_ARATH; NAC transcription factor 56 | ||||
TrEMBL | A0A178VP09 | 0.0 | A0A178VP09_ARATH; NARS1 | ||||
STRING | AT3G15510.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM190 | 28 | 276 | Representative plant | OGRP17 | 15 | 800 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G15510.1 |
Entrez Gene | 820790 |
iHOP | AT3G15510 |
wikigenes | AT3G15510 |