PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G44910.1

Common Name

ATHB4, ATHB-4, HB4, T13E15.8

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

HD-ZIP

Protein Properties

Length: 318aa MW: 34815.8 Da PI: 9.6041

Description

homeobox-leucine zipper protein 4

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G44910.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	57.2	2.9e-18	162	216	2	56
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ +++k+q +Lee F+++++++ +++ LAk+l+L rqV vWFqNrRa+ k AT2G44910.1 162 RKKLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTK 216 788899***********************************************98 PP
2	HD-ZIP_I/II	123.2	1.3e-39	162	251	1	91
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 +kk+rlsk+q+ +LEe+F+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+een+rL+kev+eLr +l AT2G44910.1 162 RKKLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELR-AL 251 69*************************************************************************************9.55 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04618	1.9E-33	1	124	IPR006712	HD-ZIP protein, N-terminal
Gene3D	G3DSA:1.10.10.60	3.8E-19	143	216	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.34E-18	148	219	IPR009057	Homeodomain-like
PROSITE profile	PS50071	17.103	158	218	IPR001356	Homeobox domain
SMART	SM00389	5.0E-15	160	222	IPR001356	Homeobox domain
Pfam	PF00046	8.7E-16	162	216	IPR001356	Homeobox domain
CDD	cd00086	2.42E-13	162	219	No hit	No description
PROSITE pattern	PS00027	0	193	216	IPR017970	Homeobox, conserved site
Pfam	PF02183	1.6E-11	218	252	IPR003106	Leucine zipper, homeobox-associated
SMART	SM00340	2.9E-26	218	261	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009641	Biological Process	shade avoidance
GO:0009725	Biological Process	response to hormone
GO:0010218	Biological Process	response to far red light
GO:0005634	Cellular Component	nucleus
GO:0009506	Cellular Component	plasmodesma
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0000191	anatomy	synergid
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009031	anatomy	sepal
PO:0009046	anatomy	flower
PO:0009052	anatomy	flower pedicel
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 318 aa Download sequence Send to blast
MGERDDGLGL SLSLGNSQQK EPSLRLNLMP LTTSSSSSSF QHMHNQNNNS HPQKIHNISW 60 THLFQSSGIK RTTAERNSDA GSFLRGFNVN RAQSSVAVVD LEEEAAVVSS PNSAVSSLSG 120 NKRDLAVARG GDENEAERAS CSRGGGSGGS DDEDGGNGDG SRKKLRLSKD QALVLEETFK 180 EHSTLNPKQK LALAKQLNLR ARQVEVWFQN RRARTKLKQT EVDCEYLKRC CDNLTEENRR 240 LQKEVSELRA LKLSPHLYMH MTPPTTLTMC PSCERVSSSA ATVTAAPSTT TTPTVVGRPS 300 PQRLTPWTAI SLQQKSGR

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	160	166	SRKKLRL
2	210	218	RRARTKLKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.44957	0.0	bud

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	266814_at	0.0
Expression Atlas	AT2G44910	-
AtGenExpress	AT2G44910	-
ATTED-II	AT2G44910	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a homeodomain protein whose expression displays a dependence on phyB for both red and far-red light response. Also involved in the shade avoidance syndrome.
UniProt	Probable transcription factor. {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
ATHB4 is a novel regulatory component of the shade avoidance syndrome transcriptional network which controls auxin, brassinosteroid and gibberellin-mediated growth. [PMID: 19392702] ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis. [PMID: 22918502] a genetic system consisting of HD-Zip II and HD-Zip III genes (ATHB2, ATHB4) cooperates in establishing bilateral symmetry and patterning along the adaxial-abaxial axis in the embryo as well as in controlling SAM activity [PMID: 23578926] HB4 works as a transcriptional cofactor in the regulation of the control of vegetation proximity. [PMID: 28805249]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G44910.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By transition from light to far-red light. {ECO:0000269\|PubMed:8106086}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	auxin, Brassinosteroid, Gibberellin

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G44910

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ441251	0.0	AJ441251.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein ATHB4 (Athb4 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_182018.1	0.0	homeobox-leucine zipper protein 4
Swissprot	P92953	0.0	ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBL	A0A384LKZ1	0.0	A0A384LKZ1_ARATH; HB4
TrEMBL	C0SV86	0.0	C0SV86_ARATH; Uncharacterized protein At2g44910 (Fragment)
STRING	AT2G44910.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2577	27	72
Representative plant	OGRP196	16	156

Link Out ? help Back to Top
Phytozome	AT2G44910.1
Entrez Gene	819100
iHOP	AT2G44910
wikigenes	AT2G44910

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Oh S,Park S,Han KH Transcriptional regulation of secondary growth in Arabidopsis thaliana. J. Exp. Bot., 2003. 54(393): p. 2709-22 [PMID:14585825] Tepperman JM, et al. Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation. Plant J., 2004. 38(5): p. 725-39 [PMID:15144375] Henriksson E, et al. Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] Ma S,Gong Q,Bohnert HJ Dissecting salt stress pathways. J. Exp. Bot., 2006. 57(5): p. 1097-107 [PMID:16510518] Roig-Villanova I,Bou J,Sorin C,Devlin PF,Martínez-García JF Identification of primary target genes of phytochrome signaling. Early transcriptional control during shade avoidance responses in Arabidopsis. Plant Physiol., 2006. 141(1): p. 85-96 [PMID:16565297] Khanna R, et al. Functional profiling reveals that only a small number of phytochrome-regulated early-response genes in Arabidopsis are necessary for optimal deetiolation. Plant Cell, 2006. 18(9): p. 2157-71 [PMID:16891401] Ciarbelli AR, et al. The Arabidopsis homeodomain-leucine zipper II gene family: diversity and redundancy. Plant Mol. Biol., 2008. 68(4-5): p. 465-78 [PMID:18758690] Sorin C,Salla-Martret M,Bou-Torrent J,Roig-Villanova I,Martínez-García JF ATHB4, a regulator of shade avoidance, modulates hormone response in Arabidopsis seedlings. Plant J., 2009. 59(2): p. 266-77 [PMID:19392702] Wuest SE, et al. Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes. Curr. Biol., 2010. 20(6): p. 506-12 [PMID:20226671] Fernandez-Calvino L, et al. Arabidopsis plasmodesmal proteome. PLoS ONE, 2011. 6(4): p. e18880 [PMID:21533090] Bou-Torrent J, et al. ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis. Plant Signal Behav, 2012. 7(11): p. 1382-7 [PMID:22918502] Turchi L, et al. Arabidopsis HD-Zip II transcription factors control apical embryo development and meristem function. Development, 2013. 140(10): p. 2118-29 [PMID:23578926] Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development. Plant Signal Behav, 2014. [PMID:23838958] Francisco M, et al. Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense. Front Plant Sci, 2016. 7: p. 1010 [PMID:27462337] Gallemí M, et al. A non-DNA-binding activity for the ATHB4 transcription factor in the control of vegetation proximity. New Phytol., 2017. 216(3): p. 798-813 [PMID:28805249] Carabelli M,Sessa G,Baima S,Morelli G,Ruberti I The Arabidopsis Athb-2 and -4 genes are strongly induced by far-red-rich light. Plant J., 1993. 4(3): p. 469-79 [PMID:8106086]