Signature Domain? help Back to Top |
![Signature Domain](draw_signature_domain.php?sp=Ath&pid=AT2G27990.1) |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 30.2 | 7.4e-10 | 449 | 481 | 22 | 54 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54
++yp+ ++++ LA+++gL+ +qV++WF N R +
AT2G27990.1 449 HPYPTDSDKQMLATQTGLSRNQVSNWFINARVR 481
89*****************************88 PP
|
2 | BELL | 102.2 | 3.7e-33 | 319 | 387 | 4 | 72 |
BELL 4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
+++ kkakLl l+eeV+k+Yk y++qlqtv+ssF++vagl++a+pY+slAlk++Sr+F++L++aiae++
AT2G27990.1 319 KNRLKKAKLLFLQEEVCKWYKLYNHQLQTVMSSFNTVAGLNTATPYISLALKRTSRSFKALRTAIAEHV 387
5789**************************************************************986 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Seki M, et al.
Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] - Byrne ME,Groover AT,Fontana JR,Martienssen RA
Phyllotactic pattern and stem cell fate are determined by the Arabidopsis homeobox gene BELLRINGER. Development, 2003. 130(17): p. 3941-50 [PMID:12874117] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Bhatt AM,Etchells JP,Canales C,Lagodienko A,Dickinson H
VAAMANA--a BEL1-like homeodomain protein, interacts with KNOX proteins BP and STM and regulates inflorescence stem growth in Arabidopsis. Gene, 2004. 328: p. 103-11 [PMID:15019989] - Smith HM,Campbell BC,Hake S
Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH. Curr. Biol., 2004. 14(9): p. 812-7 [PMID:15120075] - Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12 [PMID:15781858] - Kanrar S,Onguka O,Smith HM
Arabidopsis inflorescence architecture requires the activities of KNOX-BELL homeodomain heterodimers. Planta, 2006. 224(5): p. 1163-73 [PMID:16741748] - Kanrar S,Bhattacharya M,Arthur B,Courtier J,Smith HM
Regulatory networks that function to specify flower meristems require the function of homeobox genes PENNYWISE and POUND-FOOLISH in Arabidopsis. Plant J., 2008. 54(5): p. 924-37 [PMID:18298668] - Li Y, et al.
Genome-wide identification of osmotic stress response gene in Arabidopsis thaliana. Genomics, 2008. 92(6): p. 488-93 [PMID:18804526] - Yu L,Patibanda V,Smith HM
A novel role of BELL1-like homeobox genes, PENNYWISE and POUND-FOOLISH, in floral patterning. Planta, 2009. 229(3): p. 693-707 [PMID:19082619] - Jackson SD
Plant responses to photoperiod. New Phytol., 2009. 181(3): p. 517-31 [PMID:19154317] - Rutjens B, et al.
Shoot apical meristem function in Arabidopsis requires the combined activities of three BEL1-like homeodomain proteins. Plant J., 2009. 58(4): p. 641-54 [PMID:19175771] - Smith HM,Ung N,Lal S,Courtier J
Specification of reproductive meristems requires the combined function of SHOOT MERISTEMLESS and floral integrators FLOWERING LOCUS T and FD during Arabidopsis inflorescence development. J. Exp. Bot., 2011. 62(2): p. 583-93 [PMID:20937733] - Ung N,Lal S,Smith HM
The role of PENNYWISE and POUND-FOOLISH in the maintenance of the shoot apical meristem in Arabidopsis. Plant Physiol., 2011. 156(2): p. 605-14 [PMID:21505100] - Lal S,Pacis LB,Smith HM
Regulation of the SQUAMOSA PROMOTER-BINDING PROTEIN-LIKE genes/microRNA156 module by the homeodomain proteins PENNYWISE and POUND-FOOLISH in Arabidopsis. Mol Plant, 2011. 4(6): p. 1123-32 [PMID:21653282] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] - Ung N,Smith HM
Regulation of shoot meristem integrity during Arabidopsis vegetative development. Plant Signal Behav, 2011. 6(8): p. 1250-2 [PMID:21822063] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Khan M, et al.
Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006]
|