PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G70920.1 | ||||||||
Common Name | ATHB18, ATHB-X, F15H11_25, HB18 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 206aa MW: 23519.5 Da PI: 8.6637 | ||||||||
Description | homeobox-leucine zipper protein 18 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 60.1 | 3.4e-19 | 67 | 122 | 1 | 56 |
TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rrk+ ++tkeq + Lee F +n++++ +++++LA+ l+L++rqV vWFqNrRa+ k AT1G70920.1 67 RRKKLRLTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSK 122 79999*************************************************98 PP | |||||||
2 | HD-ZIP_I/II | 109.9 | 1.8e-35 | 68 | 156 | 1 | 90 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 +kk+rl+keq++lLEesF ++++L+p++K++la+ L+l++rqv+vWFqnrRAR k+k++E+++e+Lkr++ +lke+n+rL+ eveeLr + AT1G70920.1 68 RKKLRLTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSKLKHTEMECEYLKRWFGSLKEQNRRLQIEVEELR-A 156 69*************************************************************************************9.4 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 8.36E-20 | 53 | 123 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.3E-18 | 56 | 122 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.945 | 64 | 124 | IPR001356 | Homeobox domain |
SMART | SM00389 | 2.2E-17 | 66 | 128 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.8E-16 | 67 | 122 | IPR001356 | Homeobox domain |
CDD | cd00086 | 8.25E-16 | 67 | 125 | No hit | No description |
PROSITE pattern | PS00027 | 0 | 99 | 122 | IPR017970 | Homeobox, conserved site |
SMART | SM00340 | 2.9E-16 | 124 | 167 | IPR003106 | Leucine zipper, homeobox-associated |
Pfam | PF02183 | 2.9E-9 | 124 | 158 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009005 | anatomy | root | ||||
PO:0009046 | anatomy | flower | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MALSPNSSSL DLTISIPSFS PSPSLGDHHG MRDFDINQTP KTEEDREWMI GATPHVNEDD 60 SNSGGRRRKK LRLTKEQSHL LEESFIQNHT LTPKQKKDLA TFLKLSQRQV EVWFQNRRAR 120 SKLKHTEMEC EYLKRWFGSL KEQNRRLQIE VEELRALKPS STSALTMCPR CERVTDAVDN 180 DSNAVQEGAV LSSRSRMTIS SSSSLC |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 64 | 72 | GRRRKKLRL |
2 | 65 | 71 | RRRKKLR |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 186494512 | 0.0 | ||||
Genevisible | 262311_at | 1e-126 | ||||
Expression Atlas | AT1G70920 | - | ||||
AtGenExpress | AT1G70920 | - | ||||
ATTED-II | AT1G70920 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00226 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G70920.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G70920 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK175837 | 0.0 | AK175837.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-44-P21. | |||
GenBank | AK175965 | 0.0 | AK175965.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-65-O17. | |||
GenBank | EU339186 | 0.0 | EU339186.1 Arabidopsis thaliana HD-ZIP transcription factor 18 (ATHB18) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_177248.3 | 1e-152 | homeobox-leucine zipper protein 18 | ||||
Swissprot | Q8GXM7 | 1e-153 | ATHBX_ARATH; Homeobox-leucine zipper protein ATHB-X | ||||
TrEMBL | A9Z1E8 | 1e-151 | A9Z1E8_ARATH; HD-ZIP transcription factor 18 | ||||
STRING | AT1G70920.1 | 1e-151 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13380 | 16 | 24 | Representative plant | OGRP196 | 16 | 156 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G70920.1 |
Entrez Gene | 843431 |
iHOP | AT1G70920 |
wikigenes | AT1G70920 |
Publications ? help Back to Top | |||
---|---|---|---|
|