| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | zf-B_box | 24.8 | 4.4e-08 | 14 | 57 | 3 | 40 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
+r C+ + + +++++C ++ +lC+ C + H+ H++v
AT1G68520.1 14 ARACDSCVKRRARWYCAADDAFLCHACDGSVHSAnplarrHERV 57
578*****************************657888888876 PP
|
| 2 | CCT | 68.5 | 1.8e-23 | 357 | 400 | 1 | 44 |
CCT 1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44
Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
AT1G68520.1 357 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 400
9*****************************************97 PP
|
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Robson F, et al.
Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
Plant J., 2001. 28(6): p. 619-31
[PMID:11851908] - Griffiths S,Dunford RP,Coupland G,Laurie DA
The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
Plant Physiol., 2003. 131(4): p. 1855-67
[PMID:12692345] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science, 2003. 302(5646): p. 842-6
[PMID:14593172] - Jiao Y, et al.
A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
Plant Physiol., 2003. 133(4): p. 1480-93
[PMID:14605227] - Hu W,Wang Y,Bowers C,Ma H
Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
Plant Mol. Biol., 2003. 53(4): p. 545-63
[PMID:15010618] - Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
Plant J., 2004. 38(2): p. 366-79
[PMID:15078338] - Kasukabe Y, et al.
Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana.
Plant Cell Physiol., 2004. 45(6): p. 712-22
[PMID:15215506] - Scheible WR, et al.
Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
Plant Physiol., 2004. 136(1): p. 2483-99
[PMID:15375205] - Rohde A, et al.
Molecular phenotyping of the pal1 and pal2 mutants of Arabidopsis thaliana reveals far-reaching consequences on phenylpropanoid, amino acid, and carbohydrate metabolism.
Plant Cell, 2004. 16(10): p. 2749-71
[PMID:15377757] - Fukamatsu Y, et al.
Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies.
Plant Cell Physiol., 2005. 46(8): p. 1340-9
[PMID:15937324] - Truman W,de Zabala MT,Grant M
Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
Plant J., 2006. 46(1): p. 14-33
[PMID:16553893] - Rashotte AM, et al.
A subset of Arabidopsis AP2 transcription factors mediates cytokinin responses in concert with a two-component pathway.
Proc. Natl. Acad. Sci. U.S.A., 2006. 103(29): p. 11081-5
[PMID:16832061] - Cao D,Cheng H,Wu W,Soo HM,Peng J
Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
Plant Physiol., 2006. 142(2): p. 509-25
[PMID:16920880] - Wright SI, et al.
Testing for effects of recombination rate on nucleotide diversity in natural populations of Arabidopsis lyrata.
Genetics, 2006. 174(3): p. 1421-30
[PMID:16951057] - Osuna D, et al.
Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
Plant J., 2007. 49(3): p. 463-91
[PMID:17217462] - Peng M,Bi YM,Zhu T,Rothstein SJ
Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA.
Plant Mol. Biol., 2007. 65(6): p. 775-97
[PMID:17885809] - Usadel B, et al.
Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes.
Plant Physiol., 2008. 146(4): p. 1834-61
[PMID:18305208] - Khanna R, et al.
The Arabidopsis B-box zinc finger family.
Plant Cell, 2009. 21(11): p. 3416-20
[PMID:19920209] - Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
14-3-3 proteins fine-tune plant nutrient metabolism.
FEBS Lett., 2011. 585(1): p. 143-7
[PMID:21094157] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map.
Science, 2011. 333(6042): p. 601-7
[PMID:21798944] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444]
|
