PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G47655.1 | ||||||||
Common Name | DOF1.6, F16N3.5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 209aa MW: 22292.6 Da PI: 7.203 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 112.8 | 1.5e-35 | 27 | 83 | 4 | 60 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 + l+cprC+st tkfCyynny+l+qPry+Ck+CrryWt+GG+lr+vPvGgg+r++ + AT1G47655.1 27 EPLPCPRCNSTTTKFCYYNNYNLAQPRYYCKSCRRYWTQGGTLRDVPVGGGTRRSSS 83 6789*************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 9.0E-32 | 28 | 83 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.202 | 29 | 83 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 31 | 67 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 1.0E-18 | 33 | 74 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009005 | anatomy | root | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009046 | anatomy | flower | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MPSEPNQTRP TRVQPSTAAY PPPNLAEPLP CPRCNSTTTK FCYYNNYNLA QPRYYCKSCR 60 RYWTQGGTLR DVPVGGGTRR SSSKRHRSFS TTATSSSSSS SVITTTTQEP ATTEASQTKV 120 TNLISGHGSF ASLLGLGSGN GGLDYGFGYG YGLEEMSIGY LGDSSVGEIP VVDGCGGDTW 180 QIGEIEGKSG GDSLIWPGLE ISMQTNDVK |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30694121 | 0.0 | ||||
Genevisible | 262443_at | 0.0 | ||||
Expression Atlas | AT1G47655 | - | ||||
AtGenExpress | AT1G47655 | - | ||||
ATTED-II | AT1G47655 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00189 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G47655.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G47655 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
GenBank | F16N3 | 0.0 | AC007519.2 Sequence of BAC F16N3 from Arabidopsis thaliana chromosome 1, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_564510.1 | 1e-152 | Dof-type zinc finger DNA-binding family protein | ||||
Swissprot | Q9SX97 | 1e-153 | DOF16_ARATH; Dof zinc finger protein DOF1.6 | ||||
TrEMBL | A0A178W843 | 2e-97 | A0A178W843_ARATH; Uncharacterized protein | ||||
STRING | AT1G47655.1 | 1e-152 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9465 | 24 | 35 | Representative plant | OGRP38 | 17 | 445 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G47655.1 |
Entrez Gene | 841175 |
iHOP | AT1G47655 |
wikigenes | AT1G47655 |
Publications ? help Back to Top | |||
---|---|---|---|
|