PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G26780.1 | ||||||||
Common Name | AtMYB117, LOF1, MYB117 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 280aa MW: 32756.5 Da PI: 9.606 | ||||||||
Description | myb domain protein 117 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.3 | 2.8e-16 | 98 | 143 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed +l+++v +G+ +W++Ia++++ gR++k+c++rw++ AT1G26780.1 98 RGHWRPAEDVKLKELVSIYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 143 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 59.9 | 5.7e-19 | 150 | 194 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ + AT1G26780.1 150 RRAFTEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHVV 194 678*******************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.58 | 93 | 144 | IPR017930 | Myb domain |
SMART | SM00717 | 6.5E-14 | 97 | 146 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-16 | 98 | 143 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.2E-28 | 98 | 191 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.4E-26 | 99 | 151 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.33E-11 | 101 | 142 | No hit | No description |
PROSITE profile | PS51294 | 28.155 | 145 | 199 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-15 | 149 | 197 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.1E-16 | 150 | 193 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.59E-11 | 152 | 195 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-21 | 152 | 198 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 280 aa Download sequence Send to blast |
MFITEKQVWM DEIVARRASS SWDFPFNDIN IHQHHHRHCN TSHEFEILKS PLGDVAVHEE 60 ESNNNNPNFS NSESGKKETT DSGQSWSSSS SKPSVLGRGH WRPAEDVKLK ELVSIYGPQN 120 WNLIAEKLQG RSGKSCRLRW FNQLDPRINR RAFTEEEEER LMQAHRLYGN KWAMIARLFP 180 GRTDNSVKNH WHVVMARKYR EHSSAYRRRK LMSNNPLKPH LTNNHHPNPN PNYHSFISTN 240 HYFAQPFPEF NLTHHLVNNA PITSDHNQLV LPFHCFQGSL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-32 | 96 | 199 | 5 | 108 | B-MYB |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 261274_at | 0.0 | ||||
Expression Atlas | AT1G26780 | - | ||||
AtGenExpress | AT1G26780 | - | ||||
ATTED-II | AT1G26780 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in organ boundaries. {ECO:0000269|PubMed:19542355}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes LOF1 (LATERAL ORGAN FUSION1), a MYB-domain transcription factor expressed in organ boundaries. Functions in boundary specification, meristem initiation and maintenance, and organ patterning. Also see LOF2 (At1g69560). | |||||
UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning (PubMed:19542355, PubMed:21533201). Functions in both lateral organ separation and axillary meristem formation, in part through genetic interaction with the NAC domain genes CUC2 and CUC3 and the homeobox gene STM (PubMed:19542355). May be recruited by a variety of developmental programs for the development of floral organs and the initiation of ovule outgrowth (PubMed:21533201). {ECO:0000269|PubMed:19542355, ECO:0000269|PubMed:21533201}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G26780.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G26780 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF334816 | 0.0 | AF334816.1 Arabidopsis thaliana putative transcription factor (MYB117) mRNA, complete cds. | |||
GenBank | AY519559 | 0.0 | AY519559.1 Arabidopsis thaliana MYB transcription factor (At1g26780) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_564261.1 | 0.0 | myb domain protein 117 | ||||
Swissprot | Q9LQX5 | 0.0 | MY117_ARATH; Transcription factor MYB117 | ||||
TrEMBL | A0A178WCI3 | 0.0 | A0A178WCI3_ARATH; MYB117 | ||||
STRING | AT1G26780.2 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G26780.1 |
Entrez Gene | 839219 |
iHOP | AT1G26780 |
wikigenes | AT1G26780 |