![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G07980.1 | ||||||||
Common Name | NF-YC10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 206aa MW: 23026.9 Da PI: 10.266 | ||||||||
Description | nuclear factor Y, subunit C10 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 46.4 | 8.8e-15 | 106 | 188 | 17 | 99 |
NF-YC 17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 ++ ++P+ ri++i+++d+ +i +a l+ ka e+fi ++ ++ + + k++ ++ ++++v++ + ++fl d vp++ AT1G07980.1 106 AKIKFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATEMFIERFSEEAYDSSVKDKKKFIHYKHLSSVVSNDQRYEFLADSVPEK 188 4678****************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 4.35E-21 | 90 | 188 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-21 | 109 | 172 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 1.3E-23 | 110 | 187 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MVSSKKPKEK KARSDVVVNK ASGRSKRSSG SRTKKTSNKV NIVKKKPEIY EISESSSSDS 60 VEEAIRGDEA KKSNGVVSKR GNGKSVGIPT KTSKNREEDD GGAEDAKIKF PMNRIRRIMR 120 SDNSAPQIMQ DAVFLVNKAT EMFIERFSEE AYDSSVKDKK KFIHYKHLSS VVSNDQRYEF 180 LADSVPEKLK AEAALEEWER GMTDAG |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.15420 | 0.0 | flower| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30680437 | 0.0 | ||||
Genevisible | 260622_at | 0.0 | ||||
Expression Atlas | AT1G07980 | - | ||||
AtGenExpress | AT1G07980 | - | ||||
ATTED-II | AT1G07980 | - |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G07980.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G07980 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY086815 | 0.0 | AY086815.1 Arabidopsis thaliana clone 28026 mRNA, complete sequence. | |||
GenBank | BT025266 | 0.0 | BT025266.1 Arabidopsis thaliana At1g07980 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_563803.1 | 1e-146 | nuclear factor Y, subunit C10 | ||||
TrEMBL | A0A178WGX8 | 1e-145 | A0A178WGX8_ARATH; NF-YC10 | ||||
TrEMBL | Q9LN09 | 1e-145 | Q9LN09_ARATH; At1g07980 | ||||
STRING | AT1G07980.1 | 1e-146 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM11190 | 22 | 31 | Representative plant | OGRP8670 | 11 | 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G07980.1 |
Entrez Gene | 837313 |
iHOP | AT1G07980 |
wikigenes | AT1G07980 |