![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 476603 | ||||||||
Common Name | ARALYDRAFT_476603 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 104aa MW: 11269.6 Da PI: 8.6128 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 107.4 | 8.3e-34 | 37 | 93 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm++ g egt++al+CaACgCHRnFHR+ev++e 476603 37 NVRYVECQKNHAANIGGYAVDGCREFMAA-GVEGTVDALRCAACGCHRNFHRKEVDTE 93 79**************************9.999*********************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 1.0E-37 | 2 | 102 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 7.1E-30 | 37 | 90 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 7.7E-28 | 39 | 90 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.362 | 40 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009640 | Biological Process | photomorphogenesis | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009735 | Biological Process | response to cytokinin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009741 | Biological Process | response to brassinosteroid | ||||
GO:0043392 | Biological Process | negative regulation of DNA binding | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MMKKRQMVIK QRSRNSNTSS SRTTTSSSSS SSSEISNVRY VECQKNHAAN IGGYAVDGCR 60 EFMAAGVEGT VDALRCAACG CHRNFHRKEV DTEVVCEYSP PNA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 476603 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC011765 | 1e-149 | AC011765.6 Arabidopsis thaliana chromosome 1 BAC F1M20 genomic sequence, complete sequence. | |||
GenBank | AY085327 | 1e-149 | AY085327.1 Arabidopsis thaliana clone 14583 mRNA, complete sequence. | |||
GenBank | BT024806 | 1e-149 | BT024806.1 Arabidopsis thaliana At1g74660 gene, complete cds. | |||
GenBank | CP002684 | 1e-149 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020889791.1 | 2e-71 | mini zinc finger protein 1 | ||||
Swissprot | Q9CA51 | 2e-54 | MIF1_ARATH; Mini zinc finger protein 1 | ||||
TrEMBL | D7KS39 | 5e-70 | D7KS39_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.2__1733__AT1G74660.1 | 8e-71 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM944 | 28 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74660.1 | 1e-52 | mini zinc finger 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 476603 |
Entrez Gene | 9323615 |