![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araip.X5BXA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 85aa MW: 9311.47 Da PI: 8.6179 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 105.6 | 3e-33 | 17 | 73 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm+s egt+ al+CaACgCHRnFHRrev++e Araip.X5BXA 17 NVRYGECQKNHAANIGGYAVDGCREFMAS-AGEGTSGALTCAACGCHRNFHRREVQTE 73 79**************************9.6668********************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 8.0E-29 | 1 | 82 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 4.1E-30 | 17 | 70 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.9E-26 | 19 | 70 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.485 | 20 | 69 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0048509 | Biological Process | regulation of meristem development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MKKRQVAVKT SSTVIRNVRY GECQKNHAAN IGGYAVDGCR EFMASAGEGT SGALTCAACG 60 CHRNFHRREV QTEVVCEYSP PHHQN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araip.X5BXA |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016193219.1 | 5e-58 | mini zinc finger protein 3-like | ||||
Refseq | XP_025641295.1 | 5e-58 | mini zinc finger protein 3 | ||||
Swissprot | Q2Q493 | 1e-38 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
TrEMBL | A0A445ABD4 | 1e-56 | A0A445ABD4_ARAHY; Uncharacterized protein | ||||
STRING | AES69910 | 8e-51 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18835.1 | 5e-41 | mini zinc finger |