PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.17298s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 332aa    MW: 38101.5 Da    PI: 4.7434
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.17298s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.42.8e-26958150
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                          krien++nrqvtfskRrng++KKA+ELS+LCd+++a+++fs++++l  +s
  Araha.17298s0001.1.p  9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALLMFSPSDRLSLFS 58
                          79******************************************998776 PP

2K-box19.54.1e-08121188976
                 K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleq 76 
                           + +++ e+l++e+ kL++++++ ++e+R++  + +   +++e +  e+qL + l+++ ++++++l   
  Araha.17298s0001.1.p 121 AINSDVEELEHEVYKLQQQLHMAEEELRKYEPDPIRFTTMEEYETCEKQLMDTLTRVNQRREHILSHD 188
                           5567899********************************************************99643 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.9E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.805161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.24E-29281IPR002100Transcription factor, MADS-box
CDDcd002657.90E-35275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-24323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-243859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGRVKLEIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALLMFSP SDRLSLFSGK  60
TRIEDVFSRY INLSDQEREN ALVFPDQSRR PDFQSKEYLL RTLQQLKTEN DIALQLTNPT  120
AINSDVEELE HEVYKLQQQL HMAEEELRKY EPDPIRFTTM EEYETCEKQL MDTLTRVNQR  180
REHILSHDQL SSYEASAIQQ QQNMGGPFVN DVVGGWLTEN GPNQAHLFDA SAHSAMYETL  240
LQGSSSSSNQ NNIMGESNVS NHNGDMFQEW AQAYNSTTAH NPTTLFPPMQ HQHGLVDPNM  300
EEIEIPVMKK EAQADHEVSD YDIKMPQLSS Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A8e-18190191MEF2 CHIMERA
6bz1_B8e-18190191MEF2 CHIMERA
6bz1_C8e-18190191MEF2 CHIMERA
6bz1_D8e-18190191MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.17298s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464410.0DQ446441.1 Arabidopsis thaliana clone pENTR221-At1g77980 MADS-box family protein (At1g77980) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020889797.10.0agamous-like MADS-box protein AGL66
SwissprotQ1PFC20.0AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLD7KV610.0D7KV61_ARALL; MADS-box family protein
STRINGfgenesh2_kg.2__2091__AT1G77980.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.10.0AGAMOUS-like 66
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]