 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
orange1.1g048534m |
Common Name | CISIN_1g048534mg, LOC102625725 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
Family |
bHLH |
Protein Properties |
Length: 92aa MW: 10315.6 Da PI: 9.3634 |
Description |
bHLH family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
orange1.1g048534m | genome | ICGC | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | HLH | 31.8 | 2.5e-10 | 19 | 59 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
d+iN+ ++L++llP++ +++s K+s +L+++++YI+sL
orange1.1g048534m 19 DQINDLVSKLQQLLPELRNNRSDKVSAGKVLQETCNYIRSL 59
79**************889********************99 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0009640 | Biological Process | photomorphogenesis |
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase |
GO:0046983 | Molecular Function | protein dimerization activity |
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:16527868}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. Regulates light responses by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20305124}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}. |
Best hit in Arabidopsis thaliana ? help
Back to Top |
Hit ID |
E-value |
Description |
AT1G74500.1 | 4e-39 | activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1 |