 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
orange1.1g046045m |
| Common Name | CISIN_1g046045mg |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
| Family |
YABBY |
| Protein Properties |
Length: 119aa MW: 13159.1 Da PI: 10.4352 |
| Description |
YABBY family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| orange1.1g046045m | genome | ICGC | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | YABBY | 100.7 | 3.1e-31 | 1 | 119 | 24 | 159 |
YABBY 24 vsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppv 115
v +P + l+ +vtv+CGhC++l ++ + + + + l+++e++ n+ k +as+s ss ++++ +p++p v
orange1.1g046045m 1 VGIPCKRLLDTVTVKCGHCSNLSFLSTRPPP-QGP------------SQMSLRFQEKQSFCNDFKLGNASSSSSS----TSSEPLSPKAPFV 75
67999***************98553333222.222............3344566666666666666666655554....456677899999* PP
YABBY 116 irPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159
++PPek+ r Psaynrf+keeiqrika+nP+i hreafs+aakn
orange1.1g046045m 76 VKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSTAAKN 119
*******************************************9 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269|PubMed:14729915}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. |
