PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g044991m | ||||||||
Common Name | CISIN_1g044991mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 115aa MW: 12733.4 Da PI: 10.551 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 133.4 | 5.8e-42 | 47 | 114 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 v+ + akG+nPGlivllvvgglllvfl+gnyily+yaqk+lPP+kkkPvskkk+k+e+lkqGv++PGe orange1.1g044991m 47 VKDAGAKGFNPGLIVLLVVGGLLLVFLIGNYILYMYAQKTLPPKKKKPVSKKKMKKERLKQGVSAPGE 114 566789*************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 2.2E-40 | 51 | 114 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MVRLEPRCCR NINMLSVVGT ILFFCNLFSH VYLQNVTCFN DKQGNTVKDA GAKGFNPGLI 60 VLLVVGGLLL VFLIGNYILY MYAQKTLPPK KKKPVSKKKM KKERLKQGVS APGE* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Csi.6953 | 0.0 | callus| flower| fruit| vegetative meristem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010104121.2 | 6e-28 | DNA-binding protein S1FA | ||||
Refseq | XP_024026346.1 | 6e-28 | DNA-binding protein S1FA | ||||
Swissprot | P42553 | 8e-16 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
Swissprot | Q7XLX6 | 9e-16 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A067DZ38 | 1e-76 | A0A067DZ38_CITSI; Uncharacterized protein | ||||
STRING | XP_010104121.1 | 1e-27 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2823 | 27 | 69 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g044991m |
Publications ? help Back to Top | |||
---|---|---|---|
|