![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | orange1.1g043591m | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 96aa MW: 10215.4 Da PI: 8.0522 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 104.3 | 7.9e-33 | 26 | 82 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+vrY eC+kNhAa +Gg+avDGC+Efm+s geegtaaal+CaACgCHR+FHRrev++e
orange1.1g043591m 26 SVRYAECQKNHAAGVGGYAVDGCREFMAS-GEEGTAAALTCAACGCHRSFHRREVDTE 82
79**************************9.999*********************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 5.0E-18 | 1 | 92 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 1.9E-30 | 27 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 3.3E-27 | 28 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.118 | 29 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MRKRQVVLRR EEPSRNSTAS SVTVRSVRYA ECQKNHAAGV GGYAVDGCRE FMASGEEGTA 60 AALTCAACGC HRSFHRREVD TEVVCECSSP SSTAT* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Csi.4038 | 1e-145 | flower| fruit| seed | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006482592.1 | 3e-63 | mini zinc finger protein 2 isoform X1 | ||||
| Refseq | XP_024037858.1 | 3e-63 | mini zinc finger protein 2 | ||||
| Swissprot | Q9LJW5 | 8e-44 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | V4T4C3 | 2e-62 | V4T4C3_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006431146.1 | 4e-63 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM944 | 28 | 114 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 2e-26 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | orange1.1g043591m |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




