![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g042014m | ||||||||
Common Name | CISIN_1g042014mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 170aa MW: 19492.9 Da PI: 6.1472 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.4 | 4.2e-15 | 69 | 116 | 5 | 52 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 +++rr+++NRe+ArrsR RK++ ++eL v L +eN++L ++l++ orange1.1g042014m 69 RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHV 116 689***************************************999975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.880.10 | 9.1E-6 | 30 | 83 | IPR008917 | Transcription factor, Skn-1-like, DNA-binding domain |
SMART | SM00338 | 5.4E-15 | 65 | 129 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.22 | 67 | 117 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.74E-14 | 69 | 117 | No hit | No description |
Pfam | PF00170 | 6.9E-13 | 69 | 115 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 1.21E-18 | 70 | 117 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 72 | 87 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 7.7E-13 | 84 | 142 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MQPFSEVSGL HYLLAPSLSQ FLNPILNFHQ IPPQVPEIIN SQTSSFSSNN STSDEAEEQQ 60 QQSMIINERK QRRMISNRES ARRSRMRKQK HLDELWSQVV WLRNENHQLV DKLNHVSGCH 120 DKVIQENAEL KVEATELRQM LTDLQLNSHY SSLKDLDDVP CCNAADLLG* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 81 | 88 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00389 | DAP | Transfer from AT3G30530 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006482346.1 | 1e-106 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 2e-44 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A067GA70 | 1e-121 | A0A067GA70_CITSI; Uncharacterized protein | ||||
STRING | XP_006482346.1 | 1e-105 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3112 | 26 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 1e-48 | basic leucine-zipper 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g042014m |
Publications ? help Back to Top | |||
---|---|---|---|
|