PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g038850m | ||||||||
Common Name | CISIN_1g038850mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 78aa MW: 8921.33 Da PI: 9.1737 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 49.4 | 1e-15 | 6 | 76 | 10 | 80 |
NF-YC 10 iekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdia 80 e++t+ + e+P+ r+kki+k ded++++++ea ++s++ elf+ l+ +s a e+kr+t+k d+ orange1.1g038850m 6 EEQNTETTRPEFPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLAEKSAEAAIEKKRKTIKLGDMR 76 68999999**********************************************************98876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.3E-19 | 8 | 76 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.5E-18 | 16 | 78 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 3.86E-16 | 17 | 78 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MPQEAEEQNT ETTRPEFPVG RVKKIIKLDE DINKVTSEAL FIVSRSTELF LRFLAEKSAE 60 AAIEKKRKTI KLGDMRVA |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006484092.1 | 9e-46 | nuclear transcription factor Y subunit C-4 | ||||
TrEMBL | A0A067DE78 | 1e-47 | A0A067DE78_CITSI; Uncharacterized protein (Fragment) | ||||
STRING | XP_006484092.1 | 4e-45 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12860 | 25 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G43250.1 | 2e-20 | nuclear factor Y, subunit C13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g038850m |