PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

NF-YB

Protein Properties

Length: 141aa MW: 15645.3 Da PI: 5.7093

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g038014m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	176.8	2e-55	33	128	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf++y+++lk yl++yrel orange1.1g038014m 33 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDNYADQLKRYLHRYREL 124 89****************************************************************************************** PP NF-YB 94 egek 97 ege+ orange1.1g038014m 125 EGER 128 *997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.3E-52	29	136	IPR009072	Histone-fold
SuperFamily	SSF47113	7.92E-40	35	137	IPR009072	Histone-fold
Pfam	PF00808	4.4E-28	38	102	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	3.2E-19	66	84	No hit	No description
PROSITE pattern	PS00685	0	69	85	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	3.2E-19	85	103	No hit	No description
PRINTS	PR00615	3.2E-19	104	122	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 141 aa Download sequence Send to blast
MVDSAGHNLE SYDNSYNFTV GASSGTDQDG VIKEQDRLLP IANVGRIMKQ ILPPNAKISK 60 EAKETMQECV SEFISFVTGE ASDKCHKEKR KTVNGDDICW ALATLGFDNY ADQLKRYLHR 120 YRELEGERAN QNKAGNNNNG *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	9e-46	32	123	1	92	Transcription factor HapC (Eurofung)
4g92_B	9e-46	32	123	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006480108.1	1e-102	nuclear transcription factor Y subunit B-5
Refseq	XP_024045102.1	1e-102	nuclear transcription factor Y subunit B-5
Swissprot	O82248	7e-63	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A067H5N9	1e-101	A0A067H5N9_CITSI; Uncharacterized protein
STRING	XP_006480108.1	1e-102	(Citrus sinensis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	8e-64	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	orange1.1g038014m
Entrez Gene	102623450

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]