![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g036580m | ||||||||
Common Name | CISIN_1g036580mg, LOC102609097 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 187aa MW: 20242.7 Da PI: 7.0602 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.5 | 4e-58 | 25 | 120 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+++re+ orange1.1g036580m 25 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQRFREM 116 89****************************************************************************************** PP NF-YB 94 egek 97 egek orange1.1g036580m 117 EGEK 120 **97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.9E-54 | 22 | 125 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.3E-40 | 27 | 123 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.8E-28 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.5E-21 | 58 | 76 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.5E-21 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 5.5E-21 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MGDSDNDSGG ERERQHGSSR ELSPREQDRF LPIANVSRIM KKALPANAKI SKDAKETVQE 60 CVSEFISFVT GEASDKCQRE KRKTINGDDL LWAMTTLGFE EYVEPLKVYL QRFREMEGEK 120 MARDKDAPPG HGVGGAIGGE YGGMMMMGHG GQLNQGNVYG SGGFHHQMAM SSKGGPTSGG 180 SLGRPR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 8e-48 | 22 | 115 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 8e-48 | 22 | 115 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006452586.1 | 1e-136 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_006474895.1 | 1e-136 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 3e-69 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A067EZ04 | 1e-135 | A0A067EZ04_CITSI; Uncharacterized protein | ||||
TrEMBL | V4UTD6 | 1e-135 | V4UTD6_9ROSI; Uncharacterized protein | ||||
STRING | XP_006474895.1 | 1e-136 | (Citrus sinensis) | ||||
STRING | XP_006452586.1 | 1e-136 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-71 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g036580m |
Entrez Gene | 102609097 |
Publications ? help Back to Top | |||
---|---|---|---|
|