|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
orange1.1g036058m |
Common Name | CISIN_1g036058mg |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
Family |
M-type_MADS |
Protein Properties |
Length: 81aa MW: 9288.09 Da PI: 10.7524 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
orange1.1g036058m | genome | ICGC | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 77.1 | 1.3e-24 | 9 | 55 | 1 | 47 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
k+ien + r++tf+kR+ g+ KKA+E+S+LCd+eva+iifs+ gkl
orange1.1g036058m 9 KKIENRTYRHITFAKRKSGLVKKAYEISTLCDVEVALIIFSPAGKLI 55
78*******************************************96 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
5f28_A | 2e-18 | 1 | 79 | 1 | 80 | MEF2C |
5f28_B | 2e-18 | 1 | 79 | 1 | 80 | MEF2C |
5f28_C | 2e-18 | 1 | 79 | 1 | 80 | MEF2C |
5f28_D | 2e-18 | 1 | 79 | 1 | 80 | MEF2C |
6c9l_A | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |