 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
orange1.1g033282m |
Common Name | CISIN_1g030647mg |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
Family |
NF-YB |
Protein Properties |
Length: 123aa MW: 13615.5 Da PI: 5.9376 |
Description |
NF-YB family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
orange1.1g033282m | genome | ICGC | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NF-YB | 182.5 | 3.5e-57 | 25 | 117 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yre
orange1.1g033282m 25 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLTRYRE 116
69*****************************************************************************************9 PP
NF-YB 93 l 93
+
orange1.1g033282m 117 V 117
8 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0005634 | Cellular Component | nucleus |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
GO:0046982 | Molecular Function | protein heterodimerization activity |
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1n1j_A | 4e-48 | 24 | 116 | 1 | 93 | NF-YB |
4awl_B | 4e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 4e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |