![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | orange1.1g031572m | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 158aa MW: 17473.6 Da PI: 5.6788 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 140.1 | 7.1e-44 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +CaaCk lrrkC +dCv+apyfp e+p+kf nvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l+ orange1.1g031572m 10 PCAACKCLRRKCMPDCVFAPYFPPEEPQKFVNVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVMRLQR 101 7******************************************************************************************* PP DUF260 93 elallke 99 el+++++ orange1.1g031572m 102 ELDATNA 108 **99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.087 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.2E-43 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MASSSYSNAP CAACKCLRRK CMPDCVFAPY FPPEEPQKFV NVHKIFGASN VSKLLNEVLP 60 HQREDAVNSL AYEAEARLKD PVYGCVGAIS VLQRQVMRLQ RELDATNADL IRYACNEMPP 120 QFGARSDTNE QNSGFYFPSQ WNNNNDGSHE GGESSSM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 4e-66 | 3 | 118 | 4 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 4e-66 | 3 | 118 | 4 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006470257.1 | 1e-116 | LOB domain-containing protein 25 | ||||
Refseq | XP_006470258.1 | 1e-116 | LOB domain-containing protein 25 | ||||
Refseq | XP_006470259.1 | 1e-116 | LOB domain-containing protein 25 | ||||
Refseq | XP_024047294.1 | 1e-116 | LOB domain-containing protein 25 | ||||
Refseq | XP_024047295.1 | 1e-116 | LOB domain-containing protein 25 | ||||
Refseq | XP_024047296.1 | 1e-116 | LOB domain-containing protein 25 | ||||
Refseq | XP_024047297.1 | 1e-116 | LOB domain-containing protein 25 | ||||
Swissprot | Q8L8Q3 | 2e-67 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
TrEMBL | V4UC44 | 1e-114 | V4UC44_9ROSI; Uncharacterized protein | ||||
STRING | XP_006446576.1 | 1e-115 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27650.1 | 9e-70 | LOB domain-containing protein 25 |
Link Out ? help Back to Top | |
---|---|
Phytozome | orange1.1g031572m |
Publications ? help Back to Top | |||
---|---|---|---|
|