PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

SBP

Protein Properties

Length: 175aa MW: 19149.3 Da PI: 8.8206

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
orange1.1g030599m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	75.6	8.1e-24	66	112	2	48
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 Cqv++C adls+ak+yhrrhkvCevh+ka+vvl+ g++qrfCqqCsr orange1.1g030599m 66 CQVDKCGADLSDAKQYHRRHKVCEVHAKAQVVLMGGIRQRFCQQCSR 112 **********************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	3.8E-24	58	112	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	20.726	63	124	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	4.32E-26	65	127	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.0E-17	66	119	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 175 aa Download sequence Send to blast
MDAKRKNKMV KVVKKEEATA AFVDSDDDDD DGGEYDLCPQ EEGDDNRNSS SKKNKGSSGG 60 SGLRSCQVDK CGADLSDAKQ YHRRHKVCEV HAKAQVVLMG GIRQRFCQQC SRRLAGHNER 120 RRKNAAESNG EGSSCKGTGT GTQLKDLVCG KLDDKGRIKI SIQENATCKH FQIR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	2e-28	56	123	1	84	squamosa promoter binding protein-like 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Csi.1691	1e-137	fruit

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:14573523}.
Uniprot	TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269\|PubMed:10524240}.

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:16914499}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00634	PBM	Transfer from PK22320.1	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305\|PubMed:12202040, ECO:0000305\|PubMed:16914499}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006469892.1	4e-98	squamosa promoter-binding protein 1-like
Refseq	XP_024047844.1	4e-98	squamosa promoter-binding protein 1
Swissprot	Q9S7A9	9e-29	SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBL	A0A067DH01	1e-123	A0A067DH01_CITSI; Uncharacterized protein
STRING	XP_006469892.1	1e-97	(Citrus sinensis)
STRING	XP_006447265.1	1e-97	(Citrus clementina)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G53160.2	7e-30	squamosa promoter binding protein-like 4

Link Out ? help Back to Top
Phytozome	orange1.1g030599m

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Hyun Y, et al. Site-directed mutagenesis in Arabidopsis thaliana using dividing tissue-targeted RGEN of the CRISPR/Cas system to generate heritable null alleles. Planta, 2015. 241(1): p. 271-84 [PMID:25269397] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] Ioannidi E, et al. Trichome patterning control involves TTG1 interaction with SPL transcription factors. Plant Mol. Biol., 2016. 92(6): p. 675-687 [PMID:27631431] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142]