![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna22510.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 156aa MW: 17585.7 Da PI: 5.7432 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 156.3 | 5e-49 | 6 | 100 | 2 | 96 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 +eqdr+lPianv+rimk+ lP++ak+sk+ak+ +qec++ef+sfvt+easdkc++e+rkt+ngdd++wa++ lGf++y+e+ + yl mrna22510.1-v1.0-hybrid 6 EEQDRLLPIANVGRIMKQGLPQRAKVSKEAKQRMQECATEFLSFVTAEASDKCHKENRKTVNGDDICWAMSALGFDNYAEATTRYL 91 69************************************************************************************ PP NF-YB 88 kkyrelege 96 +kyre+e++ mrna22510.1-v1.0-hybrid 92 NKYREAERH 100 ******997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-46 | 5 | 108 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.35E-36 | 8 | 114 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-24 | 11 | 75 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.0E-17 | 39 | 57 | No hit | No description |
PRINTS | PR00615 | 1.0E-17 | 58 | 76 | No hit | No description |
PRINTS | PR00615 | 1.0E-17 | 77 | 95 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MVDHEEEQDR LLPIANVGRI MKQGLPQRAK VSKEAKQRMQ ECATEFLSFV TAEASDKCHK 60 ENRKTVNGDD ICWAMSALGF DNYAEATTRY LNKYREAERH RLAANQSNIN INTSSSSQLE 120 IREGDQLPIY LSGTQPSNLE FRILEMGDNS FAKPS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-41 | 7 | 96 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-41 | 7 | 96 | 3 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna22510.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004302413.1 | 1e-115 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O04027 | 1e-50 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A2P6R739 | 3e-98 | A0A2P6R739_ROSCH; Putative transcription factor Hap3/NF-YB family | ||||
STRING | XP_004302413.1 | 1e-114 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 4e-52 | nuclear factor Y, subunit B4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna22510.1-v1.0-hybrid |
Publications ? help Back to Top | |||
---|---|---|---|
|