PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna13354.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 215aa MW: 24454.8 Da PI: 7.9664 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97 | 7.8e-31 | 17 | 67 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaevavi+fs++g+lye+ss mrna13354.1-v1.0-hybrid 17 KRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIVFSQKGRLYEFSS 67 79***********************************************96 PP | |||||||
2 | K-box | 76.1 | 9.3e-26 | 68 | 157 | 6 | 95 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 + +l+ + ++l++e+a + k+ie L+ +qR+llG dL+s+s +eL+q+ +qLe+s++ +R++K +l++eqie+lq ke+ l een mrna13354.1-v1.0-hybrid 68 SDNLNILQVQQLKHESADMAKKIEILEASQRRLLGHDLDSCSAQELNQISSQLERSIRIVRDRKGQLFMEQIERLQAKERILLEEN 153 4447777899**************************************************************************** PP K-box 92 kaLr 95 ++L+ mrna13354.1-v1.0-hybrid 154 TKLH 157 **97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.772 | 9 | 69 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.9E-42 | 9 | 68 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.68E-39 | 11 | 74 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 11 | 65 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.02E-30 | 11 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-31 | 11 | 31 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.9E-27 | 18 | 65 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-31 | 31 | 46 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-31 | 46 | 67 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.1E-23 | 75 | 158 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.657 | 76 | 166 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MENNGREEMV RGKIEMKRIE NATSRQVTFS KRRNGLLKKA YELSVLCDAE VAVIVFSQKG 60 RLYEFSSSDN LNILQVQQLK HESADMAKKI EILEASQRRL LGHDLDSCSA QELNQISSQL 120 ERSIRIVRDR KGQLFMEQIE RLQAKERILL EENTKLHIAC GARPWQQHIV QEKEVGAATY 180 NWMNSSQSSS SQTISNSDQV ETGLFIGPPA MRCE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n6j_A | 2e-19 | 11 | 102 | 2 | 93 | Myocyte-specific enhancer factor 2B |
1n6j_B | 2e-19 | 11 | 102 | 2 | 93 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna13354.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU024863 | 2e-99 | EU024863.1 Fragaria vesca subsp. americana clone fosmid 52I20, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004308127.1 | 1e-129 | PREDICTED: MADS-box protein SOC1-like isoform X2 | ||||
Swissprot | Q9FIS1 | 3e-68 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A2P6SMU0 | 1e-116 | A0A2P6SMU0_ROSCH; Putative transcription factor MADS-MIKC family | ||||
STRING | XP_004308127.1 | 1e-129 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 1e-67 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna13354.1-v1.0-hybrid |