PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna12120.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 236aa MW: 25663.2 Da PI: 7.9139 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 72 | 5.1e-23 | 13 | 60 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 +i+n rqvtfskRr g+lKKA ELSvLCd e aviifs tgkl+e mrna12120.1-v1.0-hybrid 13 KIDNLPARQVTFSKRRRGLLKKAGELSVLCDCEYAVIIFSATGKLFES 60 6899999**************************************985 PP | |||||||
2 | K-box | 45.4 | 3.5e-16 | 92 | 170 | 20 | 98 |
K-box 20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + kL k + + r +R++ GedLe L++ eLq+Le+q+e +l+++ ++K+e ++++i l k +l ++n++Lr+++ mrna12120.1-v1.0-hybrid 92 DRIKLSKDLAEKSRVLRQMNGEDLEGLNIDELQKLEKQIEGGLSRVLQTKEEKIMSEILALEAKGAQLLQANNQLRQRI 170 5556666666667889************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 26.212 | 4 | 64 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.7E-31 | 4 | 63 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.71E-32 | 5 | 73 | No hit | No description |
SuperFamily | SSF55455 | 3.53E-26 | 5 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-23 | 6 | 26 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-20 | 13 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-23 | 26 | 41 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-23 | 41 | 62 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.889 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.8E-15 | 89 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009005 | anatomy | root | ||||
PO:0007134 | developmental stage | sporophyte vegetative stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 236 aa Download sequence Send to blast |
MTKPARNKIK IRKIDNLPAR QVTFSKRRRG LLKKAGELSV LCDCEYAVII FSATGKLFES 60 SSSSTKDVIA RYKAHIENVE KLEQPSIELQ PDRIKLSKDL AEKSRVLRQM NGEDLEGLNI 120 DELQKLEKQI EGGLSRVLQT KEEKIMSEIL ALEAKGAQLL QANNQLRQRI GMLSVANGKN 180 AGVIALESDN STAEEGLSSE SGTSGSSCCA NGSSPDDDSA DDTLSLKLGL IPYRG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 3e-18 | 6 | 75 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_B | 3e-18 | 6 | 75 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_C | 3e-18 | 6 | 75 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_D | 3e-18 | 6 | 75 | 2 | 71 | Myocyte-specific enhancer factor 2A |
5f28_A | 3e-18 | 6 | 77 | 3 | 74 | MEF2C |
5f28_B | 3e-18 | 6 | 77 | 3 | 74 | MEF2C |
5f28_C | 3e-18 | 6 | 77 | 3 | 74 | MEF2C |
5f28_D | 3e-18 | 6 | 77 | 3 | 74 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna12120.1-v1.0-hybrid |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004299728.1 | 1e-169 | PREDICTED: MADS-box protein JOINTLESS-like | ||||
Refseq | XP_011464657.1 | 1e-169 | PREDICTED: MADS-box protein JOINTLESS-like | ||||
Refseq | XP_011464658.1 | 1e-169 | PREDICTED: MADS-box protein JOINTLESS-like | ||||
Swissprot | Q9FVC1 | 2e-71 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A2P6PH14 | 1e-133 | A0A2P6PH14_ROSCH; Putative transcription factor MADS-MIKC family | ||||
STRING | XP_004299728.1 | 1e-168 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF890 | 33 | 106 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 5e-62 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna12120.1-v1.0-hybrid |