PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

DBB

Protein Properties

Length: 183aa MW: 20336.1 Da PI: 5.8626

Description

DBB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
maker-scaffold03455-snap-gene-0.16-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-B_box	24.8	4.4e-08	4	33	5	34
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeH 34 C+ +e+ ++++fC ++ lC+ C ++ H maker-scaffold03455-snap-gene-0.16-mRNA-1 4 LCDVCESAPAIIFCAADEAALCQACDEKVH 33 7**************************998 PP
2	zf-B_box	28.4	3.3e-09	52	91	2	37
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHkg....H 37 + ++C+ +e+ ++ ++Ce +++ lC +C ++ H g H maker-scaffold03455-snap-gene-0.16-mRNA-1 52 SVPRCDICENAPAFFYCEIDGSSLCLQCDMTVHVGgkrtH 91 5789****************************96544455 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50119	10.04	1	47	IPR000315	B-box-type zinc finger
SMART	SM00336	9.7E-9	1	47	IPR000315	B-box-type zinc finger
Pfam	PF00643	8.3E-7	3	34	IPR000315	B-box-type zinc finger
CDD	cd00021	1.62E-6	3	45	No hit	No description
SMART	SM00336	3.5E-11	51	96	IPR000315	B-box-type zinc finger
PROSITE profile	PS50119	9.214	51	96	IPR000315	B-box-type zinc finger
Pfam	PF00643	5.5E-7	53	90	IPR000315	B-box-type zinc finger
CDD	cd00021	4.62E-7	54	84	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005622	Cellular Component	intracellular
GO:0008270	Molecular Function	zinc ion binding

Sequence ? help Back to Top
Protein Sequence Length: 183 aa Download sequence Send to blast
MRTLCDVCES APAIIFCAAD EAALCQACDE KVHLCNKLAS RHVRVGLADP SSVPRCDICE 60 NAPAFFYCEI DGSSLCLQCD MTVHVGGKRT HARYLLLRQR IEFPGDKPGR LEELGMQSLD 120 PNQARRELSQ PPTLTMRENQ ENHMPSPVPV LHNNIGGDDN IENQMIDLNT RPQRVHGQAS 180 TNQ

Functional Description ? help Back to Top
Source	Description
UniProt	Acts as negative regulator of seedling photomorphogenesis (PubMed:18540109). Acts as a negative regulator of blue light-mediated inhibition of hypocotyl elongation through increase of bioactive gibberellin levels (PubMed:20872270). Acts as a repressor of thermotolerance by modulating expression of a set of heat shock-responsive genes (PubMed:23238922). {ECO:0000269\|PubMed:18540109, ECO:0000269\|PubMed:20872270, ECO:0000269\|PubMed:23238922}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By blue light (PubMed:20872270) and heat shock (at protein level) (PubMed:23238922). {ECO:0000269\|PubMed:20872270, ECO:0000269\|PubMed:23238922}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EF145766	4e-50	EF145766.1 Populus trichocarpa clone WS0113_E07 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023884352.1	1e-126	B-box zinc finger protein 18-like isoform X1
Refseq	XP_023884353.1	1e-126	B-box zinc finger protein 18-like isoform X1
Swissprot	Q9SJU5	1e-73	BBX18_ARATH; B-box zinc finger protein 18
TrEMBL	A0A2N9FQ11	1e-117	A0A2N9FQ11_FAGSY; Uncharacterized protein
STRING	cassava4.1_016111m	1e-107	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2734	33	70

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G21320.1	6e-76	DBB family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhang X,Lin R Light signaling differentially regulates the expression of group IV of the B-box zinc finger family. Plant Signal Behav, 2017. 12(9): p. e1365213 [PMID:28922622]