|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
maker-scaffold02956-snap-gene-0.16-mRNA-1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
Family |
MYB_related |
Protein Properties |
Length: 69aa MW: 7846.8 Da PI: 8.2322 |
Description |
MYB_related family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
maker-scaffold02956-snap-gene-0.16-mRNA-1 | genome | THGP | View Nucleic Acid |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 33.1 | 1.3e-10 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
rg W++eEde+l++++ +G +W++++++ g
maker-scaffold02956-snap-gene-0.16-mRNA-1 14 RGLWSPEEDEKLINYISTHGYSNWTSVPKHAG 45
789***************************98 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. |