|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
maker-scaffold02537-snap-gene-0.13-mRNA-1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
Family |
TALE |
Protein Properties |
Length: 110aa MW: 13122 Da PI: 10.6405 |
Description |
TALE family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
maker-scaffold02537-snap-gene-0.13-mRNA-1 | genome | THGP | View Nucleic Acid |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 30.4 | 6.6e-10 | 53 | 87 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55
k +yp++ ++ LA+++gL+++q+ +WF N+R ++
maker-scaffold02537-snap-gene-0.13-mRNA-1 53 KWPYPTEGDKIALAESTGLDQKQINNWFINQRKRH 87
679*****************************985 PP
|
2 | ELK | 28.9 | 2.6e-10 | 7 | 28 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
+LK++Llr +++++g+Lk EFs
maker-scaffold02537-snap-gene-0.13-mRNA-1 7 DLKDRLLRRFGSHIGTLKLEFS 28
6********************8 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | KC238467 | 1e-132 | KC238467.1 Betula luminifera KNOX transcription factor 2 (KNOX2) mRNA, complete cds. |